Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0S6XLJ6

Protein Details
Accession A0A0S6XLJ6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
402-423AANKQKSTTAKHSSSKKGRKTGHydrophilic
NLS Segment(s)
PositionSequence
378-423KRGAKARAESKKDESKKTPEASEKAANKQKSTTAKHSSSKKGRKTG
Subcellular Location(s) plas 8, E.R. 5, mito 4, extr 3, pero 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00106  adh_short  
Amino Acid Sequences MPVPLVSQVFRDGIESVPFLATALKVIAVLTFLYFAKSYFQGSSNRSERNMHGKVILVTGGTSGIGAEVVRGLASRGAQIVLLTQHPVGDLFLVEYIEDLRTQTGNQLITAEQVDLASLHSIRTFATKWIDNAPPRRLDMIILCASTLTPKGKTLQSTEDGVESNWGVNYLANFHLLSILSPALRAQPPDRDVRVIMGTCVSYLGGELPAQSQKEAEGEHHKKASAPDSTVAPASAFSPAAAHASSKLALMTFAQAFQKHLASYARPDKQPMNTRVLLVDPGFSRTPGMRRYLSWGSLIGLALYLIMYPFWWLVLKSPEMGAETFLYAAMEAQYGRGEGGWLLKECREVKLSREDIKDEAAQKALWEYSESVVQEAEKRGAKARAESKKDESKKTPEASEKAANKQKSTTAKHSSSKKGRKTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.15
5 0.14
6 0.13
7 0.13
8 0.11
9 0.09
10 0.09
11 0.08
12 0.08
13 0.08
14 0.08
15 0.07
16 0.08
17 0.07
18 0.08
19 0.08
20 0.1
21 0.1
22 0.1
23 0.13
24 0.14
25 0.16
26 0.17
27 0.21
28 0.25
29 0.29
30 0.38
31 0.41
32 0.43
33 0.43
34 0.45
35 0.46
36 0.5
37 0.5
38 0.42
39 0.38
40 0.37
41 0.36
42 0.33
43 0.28
44 0.18
45 0.15
46 0.13
47 0.11
48 0.08
49 0.07
50 0.05
51 0.04
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.07
61 0.07
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.11
70 0.11
71 0.1
72 0.1
73 0.1
74 0.11
75 0.09
76 0.07
77 0.07
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.08
89 0.08
90 0.11
91 0.13
92 0.13
93 0.13
94 0.14
95 0.13
96 0.14
97 0.15
98 0.12
99 0.08
100 0.08
101 0.08
102 0.06
103 0.07
104 0.07
105 0.06
106 0.06
107 0.06
108 0.07
109 0.07
110 0.1
111 0.11
112 0.12
113 0.17
114 0.18
115 0.2
116 0.25
117 0.31
118 0.34
119 0.4
120 0.42
121 0.4
122 0.4
123 0.4
124 0.34
125 0.3
126 0.25
127 0.24
128 0.21
129 0.18
130 0.16
131 0.15
132 0.14
133 0.14
134 0.15
135 0.11
136 0.1
137 0.11
138 0.15
139 0.18
140 0.2
141 0.23
142 0.25
143 0.25
144 0.27
145 0.26
146 0.24
147 0.21
148 0.19
149 0.17
150 0.12
151 0.1
152 0.07
153 0.07
154 0.06
155 0.06
156 0.06
157 0.07
158 0.08
159 0.08
160 0.08
161 0.08
162 0.09
163 0.08
164 0.08
165 0.07
166 0.07
167 0.06
168 0.06
169 0.07
170 0.09
171 0.1
172 0.11
173 0.11
174 0.16
175 0.19
176 0.24
177 0.24
178 0.23
179 0.22
180 0.22
181 0.23
182 0.18
183 0.15
184 0.11
185 0.1
186 0.09
187 0.09
188 0.07
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.05
196 0.07
197 0.08
198 0.08
199 0.07
200 0.07
201 0.08
202 0.08
203 0.1
204 0.18
205 0.22
206 0.24
207 0.25
208 0.25
209 0.25
210 0.27
211 0.29
212 0.21
213 0.19
214 0.18
215 0.18
216 0.19
217 0.18
218 0.16
219 0.11
220 0.09
221 0.08
222 0.08
223 0.06
224 0.05
225 0.05
226 0.06
227 0.07
228 0.07
229 0.06
230 0.06
231 0.07
232 0.08
233 0.07
234 0.07
235 0.06
236 0.06
237 0.07
238 0.08
239 0.07
240 0.08
241 0.1
242 0.1
243 0.11
244 0.13
245 0.13
246 0.11
247 0.13
248 0.13
249 0.13
250 0.19
251 0.27
252 0.3
253 0.3
254 0.33
255 0.35
256 0.41
257 0.49
258 0.47
259 0.45
260 0.41
261 0.41
262 0.39
263 0.36
264 0.3
265 0.21
266 0.19
267 0.12
268 0.15
269 0.14
270 0.14
271 0.14
272 0.14
273 0.19
274 0.2
275 0.24
276 0.22
277 0.23
278 0.3
279 0.32
280 0.32
281 0.28
282 0.25
283 0.22
284 0.22
285 0.21
286 0.13
287 0.09
288 0.08
289 0.06
290 0.05
291 0.04
292 0.03
293 0.03
294 0.03
295 0.04
296 0.04
297 0.04
298 0.05
299 0.05
300 0.09
301 0.13
302 0.14
303 0.14
304 0.14
305 0.15
306 0.16
307 0.16
308 0.14
309 0.11
310 0.11
311 0.1
312 0.1
313 0.08
314 0.07
315 0.07
316 0.06
317 0.05
318 0.05
319 0.06
320 0.06
321 0.06
322 0.06
323 0.06
324 0.06
325 0.06
326 0.1
327 0.12
328 0.13
329 0.15
330 0.16
331 0.23
332 0.23
333 0.26
334 0.27
335 0.26
336 0.29
337 0.37
338 0.43
339 0.44
340 0.46
341 0.46
342 0.42
343 0.45
344 0.46
345 0.38
346 0.34
347 0.28
348 0.24
349 0.22
350 0.23
351 0.19
352 0.15
353 0.14
354 0.14
355 0.14
356 0.18
357 0.17
358 0.15
359 0.15
360 0.16
361 0.18
362 0.19
363 0.23
364 0.23
365 0.24
366 0.29
367 0.35
368 0.36
369 0.4
370 0.48
371 0.53
372 0.57
373 0.61
374 0.64
375 0.69
376 0.74
377 0.74
378 0.72
379 0.71
380 0.73
381 0.72
382 0.71
383 0.69
384 0.66
385 0.64
386 0.66
387 0.62
388 0.63
389 0.67
390 0.63
391 0.56
392 0.56
393 0.57
394 0.57
395 0.6
396 0.59
397 0.6
398 0.64
399 0.7
400 0.76
401 0.79
402 0.8
403 0.82