Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0S6XKH2

Protein Details
Accession A0A0S6XKH2   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-92DRPAVRWKSKRQSGNPCRPRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9, cyto_nucl 7, cyto 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021648  GLUE_dom  
IPR011993  PH-like_dom_sf  
IPR037855  Vps36  
Gene Ontology GO:0000814  C:ESCRT II complex  
GO:0031902  C:late endosome membrane  
GO:0032266  F:phosphatidylinositol-3-phosphate binding  
GO:0043130  F:ubiquitin binding  
GO:0043328  P:protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway  
Pfam View protein in Pfam  
PF11605  Vps36_ESCRT-II  
PROSITE View protein in PROSITE  
PS51495  GLUE  
Amino Acid Sequences MHKVSARRMDKRTTFQWWASAAPPESSNRRVAVRRVRKVCEEVIIQPTPRRQNNDARRASHCTNTRTRPPPDRPAVRWKSKRQSGNPCRPRVITILMTLRPLNLTTALRPSLLPDEVLLFVQDSVGLYRDKFKIEGHQDGHAYLTSHRICYVDNEEPRQRSVAISLKDVDYPDFYVRDRHPHGRIYFKQTLTQSGRVSQVFPQDNLISKGKPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.58
4 0.5
5 0.45
6 0.4
7 0.4
8 0.33
9 0.28
10 0.28
11 0.28
12 0.32
13 0.33
14 0.33
15 0.3
16 0.34
17 0.37
18 0.43
19 0.49
20 0.54
21 0.61
22 0.65
23 0.67
24 0.67
25 0.67
26 0.61
27 0.55
28 0.47
29 0.41
30 0.4
31 0.38
32 0.34
33 0.33
34 0.38
35 0.41
36 0.42
37 0.45
38 0.44
39 0.52
40 0.61
41 0.68
42 0.68
43 0.63
44 0.64
45 0.64
46 0.62
47 0.59
48 0.55
49 0.51
50 0.52
51 0.55
52 0.59
53 0.59
54 0.63
55 0.64
56 0.65
57 0.69
58 0.7
59 0.7
60 0.66
61 0.7
62 0.72
63 0.72
64 0.74
65 0.73
66 0.74
67 0.75
68 0.78
69 0.76
70 0.79
71 0.79
72 0.82
73 0.82
74 0.76
75 0.71
76 0.63
77 0.57
78 0.48
79 0.41
80 0.31
81 0.26
82 0.25
83 0.23
84 0.24
85 0.22
86 0.19
87 0.15
88 0.14
89 0.11
90 0.09
91 0.09
92 0.08
93 0.11
94 0.11
95 0.11
96 0.11
97 0.12
98 0.12
99 0.12
100 0.11
101 0.08
102 0.09
103 0.09
104 0.09
105 0.08
106 0.06
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.05
113 0.06
114 0.06
115 0.1
116 0.11
117 0.12
118 0.13
119 0.14
120 0.21
121 0.26
122 0.32
123 0.3
124 0.32
125 0.32
126 0.31
127 0.31
128 0.23
129 0.19
130 0.13
131 0.18
132 0.16
133 0.16
134 0.16
135 0.16
136 0.16
137 0.19
138 0.25
139 0.25
140 0.28
141 0.34
142 0.39
143 0.4
144 0.41
145 0.38
146 0.32
147 0.25
148 0.27
149 0.28
150 0.24
151 0.25
152 0.25
153 0.25
154 0.26
155 0.26
156 0.22
157 0.17
158 0.18
159 0.17
160 0.17
161 0.17
162 0.22
163 0.23
164 0.31
165 0.36
166 0.4
167 0.42
168 0.48
169 0.52
170 0.56
171 0.6
172 0.61
173 0.62
174 0.57
175 0.59
176 0.53
177 0.58
178 0.53
179 0.54
180 0.46
181 0.42
182 0.45
183 0.4
184 0.4
185 0.34
186 0.38
187 0.35
188 0.34
189 0.35
190 0.32
191 0.35
192 0.38
193 0.39