Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9LMJ3

Protein Details
Accession A0A0C9LMJ3    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
92-118EKMAEKMHRKRVERLKRREKRNKMLKSBasic
NLS Segment(s)
PositionSequence
61-118KELKEEKDAERQRRIQAIKDRRQAKEERERYEKMAEKMHRKRVERLKRREKRNKMLKS
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MAEDQQPATATAPAQSMRKNATSGMNWHETKKPFRPTSGQTAYAKRAARDKELSVTKAHEKELKEEKDAERQRRIQAIKDRRQAKEERERYEKMAEKMHRKRVERLKRREKRNKMLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.22
4 0.25
5 0.27
6 0.26
7 0.26
8 0.29
9 0.29
10 0.3
11 0.32
12 0.36
13 0.35
14 0.36
15 0.41
16 0.4
17 0.44
18 0.48
19 0.52
20 0.47
21 0.5
22 0.54
23 0.52
24 0.57
25 0.55
26 0.53
27 0.47
28 0.49
29 0.47
30 0.46
31 0.43
32 0.34
33 0.35
34 0.31
35 0.33
36 0.32
37 0.3
38 0.31
39 0.33
40 0.33
41 0.28
42 0.29
43 0.28
44 0.27
45 0.27
46 0.24
47 0.22
48 0.27
49 0.35
50 0.34
51 0.31
52 0.33
53 0.33
54 0.39
55 0.45
56 0.45
57 0.43
58 0.45
59 0.47
60 0.51
61 0.5
62 0.48
63 0.51
64 0.56
65 0.58
66 0.63
67 0.67
68 0.61
69 0.65
70 0.63
71 0.62
72 0.62
73 0.61
74 0.6
75 0.59
76 0.6
77 0.58
78 0.61
79 0.58
80 0.5
81 0.52
82 0.52
83 0.56
84 0.62
85 0.69
86 0.69
87 0.67
88 0.74
89 0.76
90 0.8
91 0.8
92 0.82
93 0.83
94 0.85
95 0.92
96 0.93
97 0.93
98 0.93