Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WS34

Protein Details
Accession Q4WS34   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
136-169TSTSSGPGRFRRRCRGRDCRRDARRTRGWRLIGRBasic
NLS Segment(s)
PositionSequence
155-163RRDARRTRG
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
KEGG afm:AFUA_1G14160  -  
Amino Acid Sequences MIASNQGYPKQHHKCNPPLMSYHRPSYELPPPYSYGSTVRYDPDTRLLLDLDRPGATGPSTDECSSRTSTTSPSSVLDALVTDSSTTILSLSGCRLRRPSSSTTSILPPPPPPRCARRIRLPSALSVVVDIDTVLTSTSSGPGRFRRRCRGRDCRRDARRTRGWRLIGRDRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.77
4 0.7
5 0.67
6 0.67
7 0.68
8 0.64
9 0.6
10 0.52
11 0.49
12 0.48
13 0.48
14 0.48
15 0.45
16 0.43
17 0.39
18 0.4
19 0.4
20 0.39
21 0.34
22 0.28
23 0.26
24 0.26
25 0.24
26 0.24
27 0.25
28 0.25
29 0.25
30 0.27
31 0.25
32 0.23
33 0.23
34 0.21
35 0.17
36 0.18
37 0.18
38 0.14
39 0.12
40 0.12
41 0.11
42 0.11
43 0.1
44 0.08
45 0.09
46 0.1
47 0.13
48 0.13
49 0.13
50 0.14
51 0.17
52 0.19
53 0.17
54 0.16
55 0.14
56 0.17
57 0.19
58 0.19
59 0.17
60 0.15
61 0.16
62 0.14
63 0.13
64 0.1
65 0.08
66 0.07
67 0.06
68 0.06
69 0.04
70 0.04
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.07
79 0.11
80 0.12
81 0.14
82 0.16
83 0.19
84 0.21
85 0.26
86 0.29
87 0.3
88 0.34
89 0.35
90 0.34
91 0.35
92 0.35
93 0.32
94 0.28
95 0.28
96 0.31
97 0.32
98 0.34
99 0.35
100 0.39
101 0.45
102 0.52
103 0.54
104 0.57
105 0.62
106 0.64
107 0.68
108 0.63
109 0.57
110 0.52
111 0.46
112 0.35
113 0.27
114 0.21
115 0.13
116 0.11
117 0.09
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.08
126 0.1
127 0.11
128 0.16
129 0.25
130 0.36
131 0.44
132 0.52
133 0.61
134 0.69
135 0.77
136 0.83
137 0.85
138 0.86
139 0.89
140 0.9
141 0.9
142 0.9
143 0.92
144 0.9
145 0.89
146 0.88
147 0.86
148 0.86
149 0.84
150 0.82
151 0.78
152 0.79