Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WNV3

Protein Details
Accession Q4WNV3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-80IEIVKKEYEEKQRRKKEKEKEKKADDEPKNBasic
NLS Segment(s)
PositionSequence
59-90EEKQRRKKEKEKEKKADDEPKNSDKKSKKSDK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Gene Ontology GO:0005768  C:endosome  
GO:0007034  P:vacuolar transport  
KEGG afm:AFUA_4G07070  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSLPNVWHLRRVADTAAKACFVCYKPSASVLITPDNKAAAKAKQEALAREIEIVKKEYEEKQRRKKEKEKEKKADDEPKNSDKKSKKSDKESDSGAKSLEKERDEKIESLTKSASSSATDDSPRIFALHKNFYQMRVDRQCNIEMAKRNRQRLQDPSAFPSVPSGDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.33
4 0.31
5 0.28
6 0.26
7 0.27
8 0.22
9 0.24
10 0.23
11 0.25
12 0.25
13 0.27
14 0.29
15 0.24
16 0.26
17 0.24
18 0.3
19 0.28
20 0.28
21 0.27
22 0.26
23 0.25
24 0.23
25 0.24
26 0.19
27 0.22
28 0.25
29 0.26
30 0.3
31 0.32
32 0.32
33 0.31
34 0.29
35 0.24
36 0.22
37 0.22
38 0.18
39 0.17
40 0.17
41 0.15
42 0.14
43 0.17
44 0.22
45 0.31
46 0.4
47 0.48
48 0.57
49 0.67
50 0.75
51 0.82
52 0.85
53 0.85
54 0.86
55 0.87
56 0.88
57 0.87
58 0.85
59 0.83
60 0.81
61 0.81
62 0.74
63 0.71
64 0.66
65 0.63
66 0.62
67 0.55
68 0.55
69 0.51
70 0.53
71 0.56
72 0.6
73 0.59
74 0.64
75 0.72
76 0.69
77 0.66
78 0.63
79 0.59
80 0.51
81 0.44
82 0.35
83 0.27
84 0.24
85 0.25
86 0.25
87 0.21
88 0.21
89 0.22
90 0.27
91 0.29
92 0.28
93 0.28
94 0.3
95 0.28
96 0.28
97 0.27
98 0.22
99 0.2
100 0.2
101 0.17
102 0.11
103 0.13
104 0.12
105 0.14
106 0.15
107 0.15
108 0.15
109 0.15
110 0.14
111 0.13
112 0.13
113 0.14
114 0.2
115 0.27
116 0.27
117 0.33
118 0.34
119 0.36
120 0.42
121 0.41
122 0.44
123 0.45
124 0.48
125 0.45
126 0.47
127 0.47
128 0.42
129 0.42
130 0.39
131 0.4
132 0.44
133 0.51
134 0.55
135 0.62
136 0.66
137 0.7
138 0.71
139 0.69
140 0.71
141 0.69
142 0.66
143 0.63
144 0.63
145 0.55
146 0.48
147 0.44