Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9LM61

Protein Details
Accession A0A0C9LM61    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
135-161DSDRGKAPRGWRWRRRRELPVWPVRKMBasic
NLS Segment(s)
PositionSequence
139-152GKAPRGWRWRRRRE
Subcellular Location(s) cyto 11.5, cyto_nucl 11, nucl 9.5, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
CDD cd02947  TRX_family  
Amino Acid Sequences MFGVRHENEFEDLNLLSASSRVSLITLWGATWCPSCKIITPLIRDLIENGVGEQHGGVSFAEVQLDSPTLGSLASRYSVSVQCETVKMLSNADRDGVPDQFIAHTAGFRQTRSTARDPCHRRGRYEEQGLLDSVDSDRGKAPRGWRWRRRRELPVWPVRKMIGAGADVMSHLVIFDCASVSGSAAKGLASCCLGKLVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.09
4 0.08
5 0.08
6 0.07
7 0.07
8 0.06
9 0.07
10 0.07
11 0.08
12 0.1
13 0.1
14 0.09
15 0.09
16 0.1
17 0.11
18 0.14
19 0.14
20 0.15
21 0.16
22 0.17
23 0.19
24 0.22
25 0.28
26 0.31
27 0.35
28 0.37
29 0.39
30 0.38
31 0.36
32 0.33
33 0.28
34 0.23
35 0.18
36 0.14
37 0.11
38 0.1
39 0.1
40 0.08
41 0.07
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.05
50 0.06
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.06
64 0.08
65 0.11
66 0.14
67 0.14
68 0.15
69 0.15
70 0.15
71 0.15
72 0.14
73 0.14
74 0.12
75 0.12
76 0.14
77 0.14
78 0.14
79 0.14
80 0.13
81 0.12
82 0.13
83 0.12
84 0.09
85 0.08
86 0.08
87 0.07
88 0.08
89 0.08
90 0.07
91 0.07
92 0.06
93 0.12
94 0.12
95 0.12
96 0.13
97 0.15
98 0.19
99 0.24
100 0.3
101 0.31
102 0.34
103 0.44
104 0.49
105 0.55
106 0.62
107 0.58
108 0.55
109 0.58
110 0.62
111 0.61
112 0.61
113 0.55
114 0.46
115 0.46
116 0.43
117 0.35
118 0.25
119 0.17
120 0.11
121 0.13
122 0.11
123 0.11
124 0.13
125 0.14
126 0.17
127 0.2
128 0.25
129 0.29
130 0.4
131 0.5
132 0.58
133 0.68
134 0.76
135 0.83
136 0.87
137 0.88
138 0.85
139 0.86
140 0.86
141 0.85
142 0.81
143 0.72
144 0.66
145 0.56
146 0.49
147 0.39
148 0.3
149 0.22
150 0.17
151 0.16
152 0.14
153 0.13
154 0.12
155 0.11
156 0.09
157 0.06
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.07
166 0.07
167 0.07
168 0.09
169 0.09
170 0.09
171 0.09
172 0.09
173 0.09
174 0.1
175 0.11
176 0.12
177 0.12
178 0.12