Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0S6XQ56

Protein Details
Accession A0A0S6XQ56    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
103-125ETNTTQAKKRSRKTLPTTPERDDHydrophilic
NLS Segment(s)
PositionSequence
110-116KKRSRKT
125-134DAPKPRRSKR
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013218  Dsn1/Mis13  
Gene Ontology GO:0000444  C:MIS12/MIND type complex  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
Pfam View protein in Pfam  
PF08202  MIS13  
Amino Acid Sequences MNRAAHNTTTAPSRRRSARHLDDDHEDSAAPPAKKVKPDTSDKRTMTTGGAARVNGATTRKGKKAYEEVDDGFSFSRSRTKRGAAKVDAPEPLKPAQEQRPSETNTTQAKKRSRKTLPTTPERDDAPKPRRSKRLSGENEDNTAGLEDPFTNQAERTATQTRPTTASRLAATAARDESPALPNGVQAERIHVPKRRETKIGLVFSETPVIRRNKAMRQTSHDSNRRSSAGLRGKRASSLIDTGASSAMPHTEVLTEDFYKHIGQSILEPRRMKQLLVWCGNRALGEKLKLGEKVKEGERQAVHAARVVQEELLADFATRNTLSNWFDRPDDSAQGVSSLVKKPNPRNIQNAAKLAELEAELARLQSEKSSWDALVASVPPSARQEPATADAQPAPLDPASIDASLLSPSQASILTTLLQPTTSDPASSSDPAAQLQSRLDSASSGLRFKLDLYHDSLHRLERYVATAGRVADDVLARSASRLEERDAQRRERAAPGQPNVKDRDVLRALGKALEKEPKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.62
4 0.64
5 0.68
6 0.73
7 0.73
8 0.7
9 0.68
10 0.67
11 0.6
12 0.5
13 0.39
14 0.29
15 0.3
16 0.32
17 0.25
18 0.23
19 0.31
20 0.35
21 0.42
22 0.48
23 0.51
24 0.52
25 0.62
26 0.7
27 0.71
28 0.76
29 0.71
30 0.68
31 0.61
32 0.54
33 0.46
34 0.42
35 0.37
36 0.32
37 0.33
38 0.29
39 0.28
40 0.27
41 0.26
42 0.22
43 0.21
44 0.22
45 0.27
46 0.34
47 0.37
48 0.42
49 0.43
50 0.48
51 0.56
52 0.55
53 0.53
54 0.53
55 0.5
56 0.49
57 0.47
58 0.4
59 0.3
60 0.26
61 0.2
62 0.15
63 0.22
64 0.2
65 0.25
66 0.29
67 0.37
68 0.44
69 0.53
70 0.61
71 0.58
72 0.64
73 0.65
74 0.63
75 0.61
76 0.55
77 0.47
78 0.41
79 0.37
80 0.31
81 0.27
82 0.3
83 0.34
84 0.41
85 0.43
86 0.46
87 0.51
88 0.53
89 0.56
90 0.5
91 0.48
92 0.48
93 0.5
94 0.49
95 0.5
96 0.56
97 0.61
98 0.67
99 0.7
100 0.71
101 0.76
102 0.8
103 0.82
104 0.82
105 0.82
106 0.81
107 0.75
108 0.69
109 0.62
110 0.58
111 0.54
112 0.55
113 0.53
114 0.54
115 0.57
116 0.62
117 0.69
118 0.7
119 0.73
120 0.72
121 0.75
122 0.76
123 0.77
124 0.77
125 0.71
126 0.67
127 0.57
128 0.48
129 0.37
130 0.29
131 0.21
132 0.11
133 0.09
134 0.06
135 0.07
136 0.09
137 0.1
138 0.1
139 0.09
140 0.12
141 0.13
142 0.14
143 0.18
144 0.21
145 0.22
146 0.26
147 0.29
148 0.29
149 0.3
150 0.31
151 0.29
152 0.27
153 0.29
154 0.24
155 0.23
156 0.22
157 0.2
158 0.19
159 0.17
160 0.16
161 0.14
162 0.13
163 0.13
164 0.14
165 0.13
166 0.14
167 0.12
168 0.11
169 0.11
170 0.14
171 0.13
172 0.14
173 0.12
174 0.15
175 0.17
176 0.2
177 0.24
178 0.27
179 0.3
180 0.36
181 0.44
182 0.44
183 0.44
184 0.44
185 0.49
186 0.51
187 0.51
188 0.44
189 0.39
190 0.36
191 0.33
192 0.35
193 0.25
194 0.18
195 0.21
196 0.23
197 0.21
198 0.25
199 0.29
200 0.32
201 0.41
202 0.47
203 0.45
204 0.5
205 0.55
206 0.58
207 0.63
208 0.63
209 0.57
210 0.53
211 0.52
212 0.45
213 0.4
214 0.33
215 0.33
216 0.36
217 0.37
218 0.39
219 0.38
220 0.38
221 0.37
222 0.37
223 0.29
224 0.21
225 0.18
226 0.15
227 0.13
228 0.12
229 0.12
230 0.11
231 0.09
232 0.07
233 0.05
234 0.05
235 0.04
236 0.04
237 0.04
238 0.05
239 0.05
240 0.07
241 0.09
242 0.09
243 0.09
244 0.09
245 0.09
246 0.09
247 0.09
248 0.09
249 0.07
250 0.07
251 0.11
252 0.2
253 0.23
254 0.27
255 0.28
256 0.27
257 0.35
258 0.35
259 0.3
260 0.25
261 0.3
262 0.34
263 0.39
264 0.4
265 0.32
266 0.32
267 0.33
268 0.29
269 0.23
270 0.18
271 0.14
272 0.15
273 0.15
274 0.16
275 0.17
276 0.2
277 0.2
278 0.2
279 0.19
280 0.22
281 0.24
282 0.28
283 0.27
284 0.3
285 0.29
286 0.28
287 0.29
288 0.27
289 0.24
290 0.21
291 0.21
292 0.16
293 0.17
294 0.15
295 0.11
296 0.1
297 0.09
298 0.07
299 0.07
300 0.06
301 0.05
302 0.05
303 0.05
304 0.06
305 0.06
306 0.07
307 0.07
308 0.12
309 0.14
310 0.16
311 0.19
312 0.19
313 0.19
314 0.2
315 0.22
316 0.2
317 0.2
318 0.19
319 0.17
320 0.15
321 0.15
322 0.14
323 0.12
324 0.13
325 0.14
326 0.16
327 0.2
328 0.27
329 0.33
330 0.43
331 0.51
332 0.52
333 0.56
334 0.6
335 0.66
336 0.64
337 0.62
338 0.53
339 0.44
340 0.4
341 0.32
342 0.26
343 0.17
344 0.13
345 0.08
346 0.08
347 0.07
348 0.07
349 0.07
350 0.06
351 0.06
352 0.06
353 0.07
354 0.08
355 0.1
356 0.12
357 0.12
358 0.13
359 0.13
360 0.12
361 0.13
362 0.12
363 0.1
364 0.1
365 0.1
366 0.1
367 0.14
368 0.15
369 0.15
370 0.15
371 0.16
372 0.18
373 0.21
374 0.22
375 0.19
376 0.19
377 0.19
378 0.19
379 0.17
380 0.15
381 0.13
382 0.11
383 0.11
384 0.09
385 0.1
386 0.12
387 0.11
388 0.11
389 0.09
390 0.1
391 0.1
392 0.11
393 0.08
394 0.06
395 0.06
396 0.07
397 0.07
398 0.07
399 0.07
400 0.07
401 0.08
402 0.09
403 0.1
404 0.09
405 0.09
406 0.09
407 0.11
408 0.14
409 0.14
410 0.13
411 0.13
412 0.16
413 0.2
414 0.21
415 0.2
416 0.18
417 0.19
418 0.19
419 0.21
420 0.19
421 0.16
422 0.17
423 0.17
424 0.15
425 0.15
426 0.14
427 0.12
428 0.13
429 0.18
430 0.19
431 0.19
432 0.18
433 0.18
434 0.18
435 0.19
436 0.24
437 0.21
438 0.22
439 0.26
440 0.31
441 0.31
442 0.35
443 0.37
444 0.35
445 0.32
446 0.32
447 0.28
448 0.25
449 0.27
450 0.28
451 0.27
452 0.24
453 0.26
454 0.24
455 0.22
456 0.2
457 0.17
458 0.15
459 0.15
460 0.14
461 0.12
462 0.13
463 0.11
464 0.12
465 0.13
466 0.14
467 0.17
468 0.18
469 0.21
470 0.3
471 0.36
472 0.46
473 0.51
474 0.54
475 0.56
476 0.58
477 0.57
478 0.56
479 0.56
480 0.55
481 0.58
482 0.6
483 0.63
484 0.63
485 0.66
486 0.63
487 0.59
488 0.54
489 0.46
490 0.48
491 0.42
492 0.41
493 0.38
494 0.36
495 0.34
496 0.35
497 0.37
498 0.31
499 0.33
500 0.39