Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0S6XA67

Protein Details
Accession A0A0S6XA67    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-106QRQRFHERPGLKRKRVRSERWRRTFKEGFKBasic
NLS Segment(s)
PositionSequence
83-104ERPGLKRKRVRSERWRRTFKEG
Subcellular Location(s) nucl 10, mito 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MAMGRLLDPDPVSDRLDPMRNTSMPRQPQLPLPLPVRLGPSLGRTVKVSQQKNIDVSRAFRQLEIMCRKNQVKQDFQRQRFHERPGLKRKRVRSERWRRTFKEGFKGMIALVKKMKQQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.31
4 0.29
5 0.31
6 0.35
7 0.34
8 0.38
9 0.42
10 0.46
11 0.46
12 0.47
13 0.44
14 0.4
15 0.44
16 0.46
17 0.44
18 0.41
19 0.37
20 0.37
21 0.35
22 0.35
23 0.32
24 0.25
25 0.22
26 0.17
27 0.18
28 0.21
29 0.21
30 0.21
31 0.19
32 0.21
33 0.26
34 0.33
35 0.33
36 0.31
37 0.35
38 0.37
39 0.39
40 0.38
41 0.34
42 0.27
43 0.27
44 0.27
45 0.27
46 0.24
47 0.2
48 0.22
49 0.2
50 0.27
51 0.32
52 0.3
53 0.27
54 0.32
55 0.33
56 0.36
57 0.41
58 0.39
59 0.41
60 0.45
61 0.55
62 0.61
63 0.65
64 0.69
65 0.66
66 0.7
67 0.65
68 0.64
69 0.6
70 0.58
71 0.62
72 0.64
73 0.71
74 0.71
75 0.73
76 0.77
77 0.8
78 0.82
79 0.83
80 0.83
81 0.84
82 0.87
83 0.9
84 0.91
85 0.84
86 0.84
87 0.83
88 0.79
89 0.78
90 0.71
91 0.63
92 0.55
93 0.51
94 0.42
95 0.38
96 0.31
97 0.25
98 0.27
99 0.27
100 0.3