Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WMT3

Protein Details
Accession Q4WMT3   
Localization Confidence High
Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-63RAFERQKLGRREKTAKSENKPBasic
274-293SPSPEKPTKKSKKATSTPATHydrophilic
NLS Segment(s)
PositionSequence
324-355PRRKNRMGQQARRALWEKKYGSGANHIKKQKE
378-388PRGKRGLGQGR
401-417RPQRGPPGGSNKKNVKD
Subcellular Location(s) nucl 16, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR037393  Bud22/SRFB1  
IPR015158  Bud22_dom  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005634  C:nucleus  
GO:0030490  P:maturation of SSU-rRNA  
KEGG afm:AFUA_6G08800  -  
Pfam View protein in Pfam  
PF09073  BUD22  
Amino Acid Sequences MPKRKFSDLNDRPSGAVDIKLARLTAKFENGVTALSRALKTARAFERQKLGRREKTAKSENKPEALARIEEEIRVIKSLNFQATAEKYLFKQLVKTKRIAESPVFLKFKERKNISTEGPRSTAEANVTARLYKSNPVKNVFPGIMDGIRQLLGLEAAAAGKKNVSEQKKGSTDQRKSESKEPSLDGGSELEEESDADSRKTASKAAARSAKVASEEADREEGSDVDMDDAESVDYSHFDARLASDSGSHSDGESDAEEASDSDNSNISRSISRSPSPEKPTKKSKKATSTPATSTTFLPSLTMGGYFSGSESEPEDLEGTAGPPRRKNRMGQQARRALWEKKYGSGANHIKKQKENEWKNRDSGWDARRGATDGTEGPRGKRGLGQGRPWQRNNNSTGGDRPQRGPPGGSNKKNVKDDKPLHPSWEAARKAKEQKSMAAFQGKKVTFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.39
3 0.32
4 0.26
5 0.22
6 0.23
7 0.23
8 0.22
9 0.2
10 0.2
11 0.23
12 0.24
13 0.26
14 0.25
15 0.25
16 0.27
17 0.26
18 0.26
19 0.23
20 0.19
21 0.16
22 0.18
23 0.18
24 0.16
25 0.17
26 0.21
27 0.22
28 0.3
29 0.33
30 0.39
31 0.43
32 0.47
33 0.56
34 0.58
35 0.65
36 0.67
37 0.72
38 0.71
39 0.76
40 0.79
41 0.77
42 0.8
43 0.81
44 0.8
45 0.78
46 0.8
47 0.77
48 0.72
49 0.66
50 0.57
51 0.52
52 0.45
53 0.39
54 0.3
55 0.28
56 0.25
57 0.23
58 0.23
59 0.21
60 0.18
61 0.18
62 0.17
63 0.13
64 0.18
65 0.23
66 0.24
67 0.22
68 0.22
69 0.27
70 0.28
71 0.3
72 0.26
73 0.22
74 0.21
75 0.26
76 0.28
77 0.23
78 0.28
79 0.33
80 0.42
81 0.45
82 0.49
83 0.47
84 0.51
85 0.53
86 0.51
87 0.45
88 0.41
89 0.41
90 0.45
91 0.41
92 0.35
93 0.41
94 0.43
95 0.48
96 0.52
97 0.53
98 0.48
99 0.53
100 0.58
101 0.55
102 0.58
103 0.54
104 0.48
105 0.46
106 0.42
107 0.39
108 0.35
109 0.31
110 0.22
111 0.22
112 0.19
113 0.19
114 0.19
115 0.18
116 0.17
117 0.17
118 0.17
119 0.2
120 0.27
121 0.31
122 0.36
123 0.39
124 0.41
125 0.41
126 0.44
127 0.37
128 0.29
129 0.24
130 0.2
131 0.17
132 0.15
133 0.13
134 0.09
135 0.09
136 0.08
137 0.07
138 0.05
139 0.05
140 0.04
141 0.04
142 0.03
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.05
149 0.09
150 0.16
151 0.2
152 0.25
153 0.27
154 0.35
155 0.39
156 0.41
157 0.46
158 0.5
159 0.51
160 0.53
161 0.58
162 0.56
163 0.57
164 0.62
165 0.6
166 0.53
167 0.51
168 0.45
169 0.41
170 0.35
171 0.31
172 0.24
173 0.17
174 0.14
175 0.11
176 0.09
177 0.07
178 0.06
179 0.05
180 0.06
181 0.07
182 0.07
183 0.07
184 0.07
185 0.08
186 0.1
187 0.11
188 0.12
189 0.14
190 0.18
191 0.2
192 0.26
193 0.32
194 0.3
195 0.32
196 0.31
197 0.28
198 0.24
199 0.23
200 0.17
201 0.13
202 0.13
203 0.12
204 0.13
205 0.11
206 0.11
207 0.11
208 0.1
209 0.07
210 0.07
211 0.06
212 0.05
213 0.05
214 0.05
215 0.04
216 0.04
217 0.04
218 0.03
219 0.04
220 0.03
221 0.04
222 0.04
223 0.05
224 0.05
225 0.05
226 0.06
227 0.06
228 0.09
229 0.09
230 0.09
231 0.09
232 0.1
233 0.12
234 0.12
235 0.12
236 0.09
237 0.09
238 0.09
239 0.08
240 0.08
241 0.07
242 0.05
243 0.05
244 0.05
245 0.05
246 0.06
247 0.06
248 0.06
249 0.05
250 0.08
251 0.08
252 0.09
253 0.09
254 0.1
255 0.11
256 0.12
257 0.17
258 0.19
259 0.21
260 0.25
261 0.3
262 0.37
263 0.42
264 0.49
265 0.51
266 0.54
267 0.64
268 0.69
269 0.73
270 0.74
271 0.76
272 0.78
273 0.79
274 0.82
275 0.78
276 0.74
277 0.67
278 0.64
279 0.58
280 0.49
281 0.42
282 0.35
283 0.28
284 0.22
285 0.19
286 0.13
287 0.11
288 0.1
289 0.09
290 0.06
291 0.06
292 0.06
293 0.06
294 0.06
295 0.07
296 0.06
297 0.07
298 0.08
299 0.08
300 0.08
301 0.09
302 0.09
303 0.08
304 0.08
305 0.07
306 0.07
307 0.1
308 0.15
309 0.17
310 0.23
311 0.28
312 0.36
313 0.4
314 0.46
315 0.52
316 0.59
317 0.67
318 0.71
319 0.76
320 0.77
321 0.74
322 0.73
323 0.68
324 0.62
325 0.57
326 0.56
327 0.48
328 0.42
329 0.46
330 0.43
331 0.4
332 0.45
333 0.49
334 0.47
335 0.54
336 0.55
337 0.54
338 0.57
339 0.62
340 0.62
341 0.63
342 0.66
343 0.69
344 0.73
345 0.73
346 0.72
347 0.67
348 0.61
349 0.55
350 0.53
351 0.47
352 0.47
353 0.44
354 0.43
355 0.42
356 0.4
357 0.36
358 0.28
359 0.26
360 0.2
361 0.22
362 0.27
363 0.27
364 0.27
365 0.32
366 0.32
367 0.3
368 0.3
369 0.36
370 0.38
371 0.44
372 0.51
373 0.55
374 0.64
375 0.72
376 0.72
377 0.73
378 0.7
379 0.7
380 0.67
381 0.64
382 0.57
383 0.52
384 0.53
385 0.52
386 0.52
387 0.49
388 0.47
389 0.48
390 0.5
391 0.5
392 0.47
393 0.46
394 0.5
395 0.57
396 0.6
397 0.62
398 0.65
399 0.71
400 0.77
401 0.76
402 0.72
403 0.72
404 0.74
405 0.75
406 0.75
407 0.69
408 0.66
409 0.6
410 0.56
411 0.53
412 0.54
413 0.5
414 0.48
415 0.51
416 0.55
417 0.63
418 0.67
419 0.68
420 0.62
421 0.64
422 0.65
423 0.64
424 0.61
425 0.62
426 0.56
427 0.52
428 0.59