Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WGB2

Protein Details
Accession Q4WGB2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-82DGPPKYRQAKSAKMKKKKPVDRPRPPPVGERKBasic
NLS Segment(s)
PositionSequence
50-87LDGPPKYRQAKSAKMKKKKPVDRPRPPPVGERKALRKR
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR019368  Ribosomal_S23/S29_mit  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG afm:AFUA_7G04420  -  
Pfam View protein in Pfam  
PF10236  DAP3  
Amino Acid Sequences MVSSFCWSCLTRLRPTTRALLPPTLATPRVAAFHSSSVQYANPTKKKVSLDGPPKYRQAKSAKMKKKKPVDRPRPPPVGERKALRKRIVLSNPNALEVQGMQDLTEETMVDSRLRGTVLGLPLPLIDPLRAVQAFKPKQGWSIFRRPGTVVRRETVELGRQFDMISGEGEDKGKVVKKIVTGVRGAGKSVHLLQAMAMAFTKKWVVFTVPEPQDLVIAHTGYAPLSDEAPNLYVQNEATAALLSRTVKANEGVLSGLKVSRAHPAFGSAVKPSTSLAELATLGINDPAVAWPVFEALWAELTATSASPGYDMAFKTRPPILATVDGLAHWMKNTEYRSADFEPIHAHDLVFVRHFLSLLKPGAGQPTLPNGGMLLYATSASNNPTVYSFEVALKQVAARQAGLNPSAPEFPQADPYSKVDKRVLDAFDSPKPSSAKEGALELQTIGGLTRDEARGFMEYFARSGLLRENINDEWVGEKWSLAGGGIVGELEKLGRRLRVMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.62
4 0.59
5 0.61
6 0.57
7 0.54
8 0.48
9 0.46
10 0.46
11 0.43
12 0.37
13 0.3
14 0.27
15 0.23
16 0.24
17 0.23
18 0.21
19 0.19
20 0.22
21 0.24
22 0.23
23 0.22
24 0.21
25 0.21
26 0.24
27 0.29
28 0.35
29 0.39
30 0.42
31 0.44
32 0.49
33 0.52
34 0.53
35 0.53
36 0.53
37 0.57
38 0.62
39 0.67
40 0.66
41 0.7
42 0.7
43 0.64
44 0.63
45 0.61
46 0.61
47 0.65
48 0.71
49 0.73
50 0.78
51 0.85
52 0.87
53 0.89
54 0.89
55 0.89
56 0.9
57 0.91
58 0.91
59 0.92
60 0.92
61 0.9
62 0.83
63 0.81
64 0.8
65 0.77
66 0.72
67 0.7
68 0.71
69 0.72
70 0.77
71 0.72
72 0.67
73 0.64
74 0.68
75 0.7
76 0.68
77 0.62
78 0.63
79 0.6
80 0.56
81 0.5
82 0.4
83 0.3
84 0.22
85 0.2
86 0.12
87 0.11
88 0.09
89 0.09
90 0.1
91 0.09
92 0.09
93 0.07
94 0.06
95 0.07
96 0.08
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.13
105 0.14
106 0.15
107 0.14
108 0.13
109 0.13
110 0.13
111 0.13
112 0.09
113 0.07
114 0.07
115 0.08
116 0.12
117 0.12
118 0.13
119 0.15
120 0.25
121 0.28
122 0.3
123 0.34
124 0.31
125 0.36
126 0.4
127 0.44
128 0.41
129 0.49
130 0.53
131 0.5
132 0.51
133 0.47
134 0.51
135 0.51
136 0.52
137 0.45
138 0.4
139 0.41
140 0.4
141 0.41
142 0.35
143 0.35
144 0.29
145 0.29
146 0.28
147 0.25
148 0.24
149 0.22
150 0.2
151 0.13
152 0.11
153 0.09
154 0.09
155 0.09
156 0.1
157 0.09
158 0.08
159 0.1
160 0.13
161 0.13
162 0.15
163 0.16
164 0.17
165 0.25
166 0.28
167 0.28
168 0.25
169 0.27
170 0.29
171 0.27
172 0.26
173 0.2
174 0.17
175 0.16
176 0.16
177 0.16
178 0.11
179 0.11
180 0.1
181 0.13
182 0.13
183 0.11
184 0.1
185 0.08
186 0.08
187 0.09
188 0.1
189 0.06
190 0.07
191 0.08
192 0.1
193 0.11
194 0.14
195 0.23
196 0.22
197 0.23
198 0.22
199 0.21
200 0.21
201 0.19
202 0.18
203 0.09
204 0.08
205 0.08
206 0.08
207 0.08
208 0.07
209 0.07
210 0.06
211 0.05
212 0.06
213 0.06
214 0.06
215 0.07
216 0.08
217 0.08
218 0.07
219 0.07
220 0.07
221 0.06
222 0.06
223 0.06
224 0.05
225 0.05
226 0.05
227 0.05
228 0.04
229 0.06
230 0.06
231 0.07
232 0.08
233 0.08
234 0.09
235 0.09
236 0.1
237 0.09
238 0.09
239 0.09
240 0.07
241 0.07
242 0.07
243 0.06
244 0.06
245 0.07
246 0.07
247 0.13
248 0.14
249 0.15
250 0.14
251 0.16
252 0.17
253 0.17
254 0.18
255 0.12
256 0.12
257 0.11
258 0.12
259 0.1
260 0.09
261 0.09
262 0.08
263 0.07
264 0.07
265 0.07
266 0.07
267 0.07
268 0.06
269 0.05
270 0.05
271 0.05
272 0.04
273 0.04
274 0.03
275 0.05
276 0.05
277 0.04
278 0.04
279 0.05
280 0.05
281 0.05
282 0.05
283 0.04
284 0.05
285 0.05
286 0.05
287 0.05
288 0.05
289 0.06
290 0.05
291 0.05
292 0.05
293 0.05
294 0.05
295 0.05
296 0.05
297 0.08
298 0.08
299 0.12
300 0.13
301 0.13
302 0.16
303 0.18
304 0.19
305 0.18
306 0.2
307 0.19
308 0.2
309 0.2
310 0.18
311 0.16
312 0.15
313 0.15
314 0.12
315 0.09
316 0.07
317 0.07
318 0.07
319 0.11
320 0.13
321 0.16
322 0.18
323 0.2
324 0.25
325 0.27
326 0.31
327 0.26
328 0.25
329 0.24
330 0.24
331 0.25
332 0.19
333 0.16
334 0.16
335 0.17
336 0.17
337 0.15
338 0.13
339 0.12
340 0.11
341 0.12
342 0.09
343 0.11
344 0.14
345 0.15
346 0.15
347 0.15
348 0.16
349 0.19
350 0.19
351 0.17
352 0.13
353 0.18
354 0.19
355 0.18
356 0.17
357 0.14
358 0.14
359 0.13
360 0.12
361 0.06
362 0.05
363 0.05
364 0.05
365 0.06
366 0.06
367 0.08
368 0.1
369 0.1
370 0.1
371 0.1
372 0.13
373 0.14
374 0.15
375 0.14
376 0.15
377 0.17
378 0.17
379 0.16
380 0.15
381 0.13
382 0.14
383 0.16
384 0.15
385 0.14
386 0.14
387 0.17
388 0.19
389 0.2
390 0.2
391 0.18
392 0.19
393 0.19
394 0.18
395 0.18
396 0.18
397 0.17
398 0.23
399 0.24
400 0.25
401 0.26
402 0.3
403 0.37
404 0.36
405 0.4
406 0.37
407 0.37
408 0.38
409 0.42
410 0.4
411 0.35
412 0.38
413 0.38
414 0.39
415 0.42
416 0.38
417 0.38
418 0.37
419 0.34
420 0.35
421 0.33
422 0.31
423 0.27
424 0.3
425 0.28
426 0.28
427 0.27
428 0.21
429 0.18
430 0.14
431 0.13
432 0.09
433 0.07
434 0.06
435 0.06
436 0.1
437 0.12
438 0.12
439 0.13
440 0.15
441 0.17
442 0.17
443 0.18
444 0.19
445 0.18
446 0.18
447 0.18
448 0.17
449 0.14
450 0.15
451 0.19
452 0.19
453 0.2
454 0.21
455 0.26
456 0.26
457 0.28
458 0.26
459 0.21
460 0.19
461 0.18
462 0.19
463 0.14
464 0.13
465 0.12
466 0.12
467 0.12
468 0.09
469 0.09
470 0.06
471 0.06
472 0.06
473 0.06
474 0.05
475 0.05
476 0.05
477 0.06
478 0.08
479 0.11
480 0.14
481 0.17