FuNGI

Q4WGB2

Protein Details

Accession

Q4WGB2

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
51-82	DGPPKYRQAKSAKMKKKKPVDRPRPPPVGERK	Basic

NLS Segment(s)

Position	Sequence
50-87	LDGPPKYRQAKSAKMKKKKPVDRPRPPPVGERKALRKR

Subcellular Location(s)

mito 25

Family & Domain DBs

InterPro	View protein in InterPro IPR019368 Ribosomal_S23/S29_mit
Gene Ontology	GO:0005763 C:mitochondrial small ribosomal subunit GO:0003735 F:structural constituent of ribosome
KEGG	afm:AFUA_7G04420 -
Pfam	View protein in Pfam PF10236 DAP3

Amino Acid Sequences

MVSSFCWSCLTRLRPTTRALLPPTLATPRVAAFHSSSVQYANPTKKKVSLDGPPKYRQAKSAKMKKKKPVDRPRPPPVGERKALRKRIVLSNPNALEVQGMQDLTEETMVDSRLRGTVLGLPLPLIDPLRAVQAFKPKQGWSIFRRPGTVVRRETVELGRQFDMISGEGEDKGKVVKKIVTGVRGAGKSVHLLQAMAMAFTKKWVVFTVPEPQDLVIAHTGYAPLSDEAPNLYVQNEATAALLSRTVKANEGVLSGLKVSRAHPAFGSAVKPSTSLAELATLGINDPAVAWPVFEALWAELTATSASPGYDMAFKTRPPILATVDGLAHWMKNTEYRSADFEPIHAHDLVFVRHFLSLLKPGAGQPTLPNGGMLLYATSASNNPTVYSFEVALKQVAARQAGLNPSAPEFPQADPYSKVDKRVLDAFDSPKPSSAKEGALELQTIGGLTRDEARGFMEYFARSGLLRENINDEWVGEKWSLAGGGIVGELEKLGRRLRVMA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.54
2	0.57
3	0.62
4	0.59
5	0.61
6	0.57
7	0.54
8	0.48
9	0.46
10	0.46
11	0.43
12	0.37
13	0.3
14	0.27
15	0.23
16	0.24
17	0.23
18	0.21
19	0.19
20	0.22
21	0.24
22	0.23
23	0.22
24	0.21
25	0.21
26	0.24
27	0.29
28	0.35
29	0.39
30	0.42
31	0.44
32	0.49
33	0.52
34	0.53
35	0.53
36	0.53
37	0.57
38	0.62
39	0.67
40	0.66
41	0.7
42	0.7
43	0.64
44	0.63
45	0.61
46	0.61
47	0.65
48	0.71
49	0.73
50	0.78
51	0.85
52	0.87
53	0.89
54	0.89
55	0.89
56	0.9
57	0.91
58	0.91
59	0.92
60	0.92
61	0.9
62	0.83
63	0.81
64	0.8
65	0.77
66	0.72
67	0.7
68	0.71
69	0.72
70	0.77
71	0.72
72	0.67
73	0.64
74	0.68
75	0.7
76	0.68
77	0.62
78	0.63
79	0.6
80	0.56
81	0.5
82	0.4
83	0.3
84	0.22
85	0.2
86	0.12
87	0.11
88	0.09
89	0.09
90	0.1
91	0.09
92	0.09
93	0.07
94	0.06
95	0.07
96	0.08
97	0.08
98	0.08
99	0.09
100	0.09
101	0.09
102	0.09
103	0.09
104	0.13
105	0.14
106	0.15
107	0.14
108	0.13
109	0.13
110	0.13
111	0.13
112	0.09
113	0.07
114	0.07
115	0.08
116	0.12
117	0.12
118	0.13
119	0.15
120	0.25
121	0.28
122	0.3
123	0.34
124	0.31
125	0.36
126	0.4
127	0.44
128	0.41
129	0.49
130	0.53
131	0.5
132	0.51
133	0.47
134	0.51
135	0.51
136	0.52
137	0.45
138	0.4
139	0.41
140	0.4
141	0.41
142	0.35
143	0.35
144	0.29
145	0.29
146	0.28
147	0.25
148	0.24
149	0.22
150	0.2
151	0.13
152	0.11
153	0.09
154	0.09
155	0.09
156	0.1
157	0.09
158	0.08
159	0.1
160	0.13
161	0.13
162	0.15
163	0.16
164	0.17
165	0.25
166	0.28
167	0.28
168	0.25
169	0.27
170	0.29
171	0.27
172	0.26
173	0.2
174	0.17
175	0.16
176	0.16
177	0.16
178	0.11
179	0.11
180	0.1
181	0.13
182	0.13
183	0.11
184	0.1
185	0.08
186	0.08
187	0.09
188	0.1
189	0.06
190	0.07
191	0.08
192	0.1
193	0.11
194	0.14
195	0.23
196	0.22
197	0.23
198	0.22
199	0.21
200	0.21
201	0.19
202	0.18
203	0.09
204	0.08
205	0.08
206	0.08
207	0.08
208	0.07
209	0.07
210	0.06
211	0.05
212	0.06
213	0.06
214	0.06
215	0.07
216	0.08
217	0.08
218	0.07
219	0.07
220	0.07
221	0.06
222	0.06
223	0.06
224	0.05
225	0.05
226	0.05
227	0.05
228	0.04
229	0.06
230	0.06
231	0.07
232	0.08
233	0.08
234	0.09
235	0.09
236	0.1
237	0.09
238	0.09
239	0.09
240	0.07
241	0.07
242	0.07
243	0.06
244	0.06
245	0.07
246	0.07
247	0.13
248	0.14
249	0.15
250	0.14
251	0.16
252	0.17
253	0.17
254	0.18
255	0.12
256	0.12
257	0.11
258	0.12
259	0.1
260	0.09
261	0.09
262	0.08
263	0.07
264	0.07
265	0.07
266	0.07
267	0.07
268	0.06
269	0.05
270	0.05
271	0.05
272	0.04
273	0.04
274	0.03
275	0.05
276	0.05
277	0.04
278	0.04
279	0.05
280	0.05
281	0.05
282	0.05
283	0.04
284	0.05
285	0.05
286	0.05
287	0.05
288	0.05
289	0.06
290	0.05
291	0.05
292	0.05
293	0.05
294	0.05
295	0.05
296	0.05
297	0.08
298	0.08
299	0.12
300	0.13
301	0.13
302	0.16
303	0.18
304	0.19
305	0.18
306	0.2
307	0.19
308	0.2
309	0.2
310	0.18
311	0.16
312	0.15
313	0.15
314	0.12
315	0.09
316	0.07
317	0.07
318	0.07
319	0.11
320	0.13
321	0.16
322	0.18
323	0.2
324	0.25
325	0.27
326	0.31
327	0.26
328	0.25
329	0.24
330	0.24
331	0.25
332	0.19
333	0.16
334	0.16
335	0.17
336	0.17
337	0.15
338	0.13
339	0.12
340	0.11
341	0.12
342	0.09
343	0.11
344	0.14
345	0.15
346	0.15
347	0.15
348	0.16
349	0.19
350	0.19
351	0.17
352	0.13
353	0.18
354	0.19
355	0.18
356	0.17
357	0.14
358	0.14
359	0.13
360	0.12
361	0.06
362	0.05
363	0.05
364	0.05
365	0.06
366	0.06
367	0.08
368	0.1
369	0.1
370	0.1
371	0.1
372	0.13
373	0.14
374	0.15
375	0.14
376	0.15
377	0.17
378	0.17
379	0.16
380	0.15
381	0.13
382	0.14
383	0.16
384	0.15
385	0.14
386	0.14
387	0.17
388	0.19
389	0.2
390	0.2
391	0.18
392	0.19
393	0.19
394	0.18
395	0.18
396	0.18
397	0.17
398	0.23
399	0.24
400	0.25
401	0.26
402	0.3
403	0.37
404	0.36
405	0.4
406	0.37
407	0.37
408	0.38
409	0.42
410	0.4
411	0.35
412	0.38
413	0.38
414	0.39
415	0.42
416	0.38
417	0.38
418	0.37
419	0.34
420	0.35
421	0.33
422	0.31
423	0.27
424	0.3
425	0.28
426	0.28
427	0.27
428	0.21
429	0.18
430	0.14
431	0.13
432	0.09
433	0.07
434	0.06
435	0.06
436	0.1
437	0.12
438	0.12
439	0.13
440	0.15
441	0.17
442	0.17
443	0.18
444	0.19
445	0.18
446	0.18
447	0.18
448	0.17
449	0.14
450	0.15
451	0.19
452	0.19
453	0.2
454	0.21
455	0.26
456	0.26
457	0.28
458	0.26
459	0.21
460	0.19
461	0.18
462	0.19
463	0.14
464	0.13
465	0.12
466	0.12
467	0.12
468	0.09
469	0.09
470	0.06
471	0.06
472	0.06
473	0.06
474	0.05
475	0.05
476	0.05
477	0.06
478	0.08
479	0.11
480	0.14
481	0.17

Q4WGB2

3D AlphaFold-predicted Structure Viewer