Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0S6XNX3

Protein Details
Accession A0A0S6XNX3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-107KEPRRPRKVLRVEQMRPRQSBasic
NLS Segment(s)
PositionSequence
88-95KEPRRPRK
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MTAWGTQAKDDARDVGAPPYRVPPRRKTTVRWLRHVRSRSSEAEGPVARGCSGARAHRVRSRADNKSRPSSAPIPHFDEFKTGQPFPKEPRRPRKVLRVEQMRPRQSQTATRHVPKQRDWAPRGSHRPGLICGDSTAVVRPWRSTPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.28
4 0.26
5 0.26
6 0.33
7 0.39
8 0.45
9 0.51
10 0.53
11 0.56
12 0.66
13 0.69
14 0.68
15 0.71
16 0.74
17 0.75
18 0.75
19 0.77
20 0.74
21 0.78
22 0.77
23 0.71
24 0.67
25 0.65
26 0.58
27 0.54
28 0.5
29 0.42
30 0.43
31 0.37
32 0.32
33 0.27
34 0.24
35 0.18
36 0.15
37 0.14
38 0.12
39 0.14
40 0.15
41 0.22
42 0.25
43 0.29
44 0.33
45 0.36
46 0.35
47 0.42
48 0.47
49 0.49
50 0.55
51 0.58
52 0.6
53 0.64
54 0.62
55 0.54
56 0.51
57 0.47
58 0.42
59 0.4
60 0.38
61 0.37
62 0.36
63 0.36
64 0.3
65 0.28
66 0.25
67 0.25
68 0.26
69 0.21
70 0.23
71 0.25
72 0.28
73 0.3
74 0.4
75 0.44
76 0.5
77 0.6
78 0.65
79 0.7
80 0.73
81 0.78
82 0.78
83 0.77
84 0.77
85 0.76
86 0.75
87 0.77
88 0.81
89 0.76
90 0.67
91 0.62
92 0.57
93 0.49
94 0.53
95 0.49
96 0.49
97 0.51
98 0.53
99 0.58
100 0.6
101 0.64
102 0.59
103 0.63
104 0.62
105 0.65
106 0.64
107 0.63
108 0.65
109 0.68
110 0.72
111 0.68
112 0.64
113 0.57
114 0.56
115 0.51
116 0.49
117 0.41
118 0.34
119 0.28
120 0.25
121 0.23
122 0.21
123 0.2
124 0.17
125 0.19
126 0.19
127 0.21