Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WWV2

Protein Details
Accession Q4WWV2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
85-116GADSRKERKVRGPSRRRRRKGAWKKLLWVKQSBasic
NLS Segment(s)
PositionSequence
89-109RKERKVRGPSRRRRRKGAWKK
Subcellular Location(s) plas 24, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009450  Plno_GlcNAc_GPI2  
Gene Ontology GO:0000506  C:glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex  
GO:0016740  F:transferase activity  
GO:0006506  P:GPI anchor biosynthetic process  
KEGG afm:AFUA_3G07170  -  
Pfam View protein in Pfam  
PF06432  GPI2  
Amino Acid Sequences MPPPPGSPPPIPPPVPVETHPNRTSSLKPPPEHRALPDPTRLAPEDAYFTSAHLRGRTANANYDDSLRALNGNTAALRPQPTYPGADSRKERKVRGPSRRRRRKGAWKKLLWVKQSYPDNYTDTETFLDHLQRNPRVRPYDFWPLVADSTVIVQHVCSVAIFVCCFVGIVQERVSPVSVVCWGSVGTAMGWILWDSWVWREHHAEQAPNAGRIADGDDGSSSSSAVSSVNPSSGATSRPVGPKDGQNEVHGLGLTISSGEPDGLLRRRSTGFSGEAYGPCEPGSPSHQASGGLSNMYLHHGSQETDETSLLSSRNRQRLSTVKSAFLIYFSLLGLSPILKSLTKSTASDSIWAMSCWLLIMNIFSFDYGSGEGAGATKFPASLSTNAAVMASTVLASRLPSTTHVFSLMLFSIEVFGLFPIFRRQLRHTSWTGHVLLTLALVIVAGGAVGMTLRGGWTAAVVGSFLGSIMTAFAMGGCSWWLISLQKYKNVVTGPWDPARPIIRRQWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.42
4 0.44
5 0.43
6 0.5
7 0.5
8 0.46
9 0.45
10 0.45
11 0.48
12 0.47
13 0.51
14 0.51
15 0.53
16 0.59
17 0.64
18 0.68
19 0.67
20 0.63
21 0.62
22 0.6
23 0.61
24 0.61
25 0.56
26 0.49
27 0.51
28 0.47
29 0.41
30 0.35
31 0.31
32 0.28
33 0.26
34 0.26
35 0.21
36 0.2
37 0.22
38 0.23
39 0.24
40 0.21
41 0.22
42 0.22
43 0.27
44 0.34
45 0.32
46 0.37
47 0.38
48 0.39
49 0.39
50 0.39
51 0.35
52 0.28
53 0.26
54 0.19
55 0.16
56 0.13
57 0.14
58 0.12
59 0.13
60 0.12
61 0.12
62 0.14
63 0.16
64 0.18
65 0.17
66 0.18
67 0.2
68 0.22
69 0.25
70 0.26
71 0.33
72 0.35
73 0.4
74 0.46
75 0.5
76 0.58
77 0.59
78 0.6
79 0.6
80 0.67
81 0.7
82 0.74
83 0.78
84 0.79
85 0.85
86 0.93
87 0.91
88 0.9
89 0.9
90 0.9
91 0.9
92 0.91
93 0.9
94 0.85
95 0.87
96 0.87
97 0.83
98 0.77
99 0.72
100 0.64
101 0.61
102 0.63
103 0.56
104 0.5
105 0.46
106 0.43
107 0.38
108 0.38
109 0.3
110 0.24
111 0.22
112 0.19
113 0.17
114 0.16
115 0.2
116 0.18
117 0.22
118 0.28
119 0.34
120 0.39
121 0.42
122 0.48
123 0.49
124 0.5
125 0.49
126 0.48
127 0.52
128 0.48
129 0.45
130 0.39
131 0.34
132 0.32
133 0.28
134 0.21
135 0.1
136 0.1
137 0.09
138 0.08
139 0.06
140 0.05
141 0.06
142 0.06
143 0.06
144 0.05
145 0.05
146 0.06
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.06
153 0.05
154 0.09
155 0.09
156 0.11
157 0.11
158 0.12
159 0.13
160 0.14
161 0.14
162 0.1
163 0.09
164 0.08
165 0.1
166 0.09
167 0.09
168 0.09
169 0.08
170 0.08
171 0.09
172 0.08
173 0.05
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.07
184 0.1
185 0.12
186 0.14
187 0.18
188 0.19
189 0.26
190 0.28
191 0.27
192 0.24
193 0.31
194 0.3
195 0.27
196 0.25
197 0.18
198 0.16
199 0.14
200 0.16
201 0.09
202 0.07
203 0.07
204 0.07
205 0.07
206 0.08
207 0.07
208 0.05
209 0.04
210 0.04
211 0.04
212 0.04
213 0.05
214 0.06
215 0.07
216 0.07
217 0.07
218 0.08
219 0.09
220 0.09
221 0.1
222 0.1
223 0.11
224 0.14
225 0.17
226 0.18
227 0.19
228 0.19
229 0.22
230 0.24
231 0.28
232 0.26
233 0.23
234 0.24
235 0.22
236 0.2
237 0.16
238 0.13
239 0.08
240 0.06
241 0.05
242 0.04
243 0.04
244 0.03
245 0.03
246 0.03
247 0.03
248 0.03
249 0.07
250 0.1
251 0.11
252 0.11
253 0.14
254 0.15
255 0.16
256 0.18
257 0.18
258 0.16
259 0.16
260 0.18
261 0.17
262 0.17
263 0.18
264 0.16
265 0.13
266 0.11
267 0.11
268 0.09
269 0.09
270 0.12
271 0.14
272 0.15
273 0.16
274 0.16
275 0.16
276 0.17
277 0.17
278 0.14
279 0.1
280 0.09
281 0.08
282 0.08
283 0.09
284 0.09
285 0.07
286 0.08
287 0.08
288 0.09
289 0.09
290 0.11
291 0.1
292 0.1
293 0.1
294 0.09
295 0.09
296 0.1
297 0.09
298 0.09
299 0.16
300 0.22
301 0.3
302 0.31
303 0.31
304 0.34
305 0.43
306 0.48
307 0.51
308 0.46
309 0.4
310 0.4
311 0.4
312 0.35
313 0.27
314 0.21
315 0.11
316 0.1
317 0.08
318 0.07
319 0.06
320 0.06
321 0.06
322 0.06
323 0.05
324 0.06
325 0.07
326 0.07
327 0.08
328 0.11
329 0.15
330 0.17
331 0.17
332 0.19
333 0.24
334 0.25
335 0.26
336 0.23
337 0.21
338 0.2
339 0.19
340 0.16
341 0.1
342 0.09
343 0.07
344 0.07
345 0.05
346 0.04
347 0.06
348 0.05
349 0.06
350 0.06
351 0.06
352 0.06
353 0.06
354 0.07
355 0.07
356 0.07
357 0.06
358 0.06
359 0.06
360 0.06
361 0.06
362 0.05
363 0.05
364 0.05
365 0.05
366 0.05
367 0.08
368 0.1
369 0.12
370 0.16
371 0.16
372 0.17
373 0.17
374 0.17
375 0.13
376 0.11
377 0.09
378 0.05
379 0.04
380 0.04
381 0.05
382 0.05
383 0.06
384 0.07
385 0.07
386 0.08
387 0.11
388 0.17
389 0.18
390 0.19
391 0.2
392 0.19
393 0.18
394 0.2
395 0.18
396 0.13
397 0.11
398 0.1
399 0.09
400 0.09
401 0.09
402 0.06
403 0.05
404 0.06
405 0.06
406 0.07
407 0.12
408 0.17
409 0.19
410 0.24
411 0.3
412 0.38
413 0.45
414 0.5
415 0.48
416 0.5
417 0.51
418 0.52
419 0.48
420 0.39
421 0.33
422 0.26
423 0.22
424 0.17
425 0.13
426 0.07
427 0.05
428 0.04
429 0.04
430 0.03
431 0.03
432 0.02
433 0.02
434 0.02
435 0.02
436 0.02
437 0.02
438 0.02
439 0.02
440 0.03
441 0.03
442 0.04
443 0.04
444 0.04
445 0.05
446 0.05
447 0.05
448 0.05
449 0.05
450 0.05
451 0.05
452 0.05
453 0.04
454 0.04
455 0.04
456 0.04
457 0.04
458 0.04
459 0.04
460 0.04
461 0.06
462 0.05
463 0.06
464 0.06
465 0.06
466 0.06
467 0.07
468 0.08
469 0.09
470 0.16
471 0.25
472 0.29
473 0.36
474 0.4
475 0.4
476 0.44
477 0.44
478 0.4
479 0.37
480 0.39
481 0.39
482 0.41
483 0.41
484 0.37
485 0.41
486 0.47
487 0.45
488 0.45