Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0S6XTW9

Protein Details
Accession A0A0S6XTW9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
267-293QEPEPKYMAKTKKQKKAELRRKAEADAHydrophilic
NLS Segment(s)
PositionSequence
275-289AKTKKQKKAELRRKA
Subcellular Location(s) nucl 14, cyto_nucl 13.833, cyto 10.5, mito_nucl 7.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR028389  POT1  
IPR032042  POT1PC  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0043047  F:single-stranded telomeric DNA binding  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF16686  POT1PC  
Amino Acid Sequences MVFDHHTIPNPDYAEGYAGGKKTIDCVSIPSSNTPSTEDQIYVMFLQSLHGEAMKAALSLQTPVRRGSFQQPPAPSVQAKSKIQDNSQAPKGPPAVRTAAGGRSFKFSLIQDTQHNKFYDLVVQVVKVFPTRFGDYIEVYVTDYTSNKNLYDYPDPNEKSDIVTEGDHLGYTSFDRKEWPGPWGQMVLRIEVRHPHADYIQNSTKEGDCVELKNVRVKFSQQGKLEANMFPDTLNPQKVLASKLNAAKSEECQQLQSRRSAYWEARQEPEPKYMAKTKKQKKAELRRKAEADARASELAEKKAQGLASDSINKHGESRNVVVLTVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.2
4 0.18
5 0.17
6 0.17
7 0.17
8 0.16
9 0.18
10 0.19
11 0.18
12 0.15
13 0.2
14 0.24
15 0.28
16 0.3
17 0.3
18 0.31
19 0.31
20 0.32
21 0.31
22 0.29
23 0.28
24 0.28
25 0.24
26 0.21
27 0.2
28 0.21
29 0.17
30 0.14
31 0.11
32 0.09
33 0.1
34 0.09
35 0.09
36 0.08
37 0.08
38 0.08
39 0.07
40 0.09
41 0.08
42 0.07
43 0.06
44 0.07
45 0.07
46 0.1
47 0.14
48 0.18
49 0.19
50 0.22
51 0.24
52 0.24
53 0.27
54 0.33
55 0.38
56 0.4
57 0.46
58 0.46
59 0.46
60 0.48
61 0.47
62 0.4
63 0.33
64 0.35
65 0.35
66 0.35
67 0.35
68 0.38
69 0.39
70 0.4
71 0.45
72 0.43
73 0.43
74 0.46
75 0.48
76 0.42
77 0.42
78 0.46
79 0.4
80 0.36
81 0.33
82 0.31
83 0.26
84 0.28
85 0.25
86 0.26
87 0.28
88 0.28
89 0.25
90 0.26
91 0.26
92 0.24
93 0.24
94 0.19
95 0.22
96 0.23
97 0.25
98 0.27
99 0.33
100 0.35
101 0.38
102 0.38
103 0.32
104 0.31
105 0.29
106 0.26
107 0.21
108 0.2
109 0.15
110 0.14
111 0.14
112 0.13
113 0.13
114 0.1
115 0.09
116 0.09
117 0.13
118 0.15
119 0.15
120 0.16
121 0.18
122 0.17
123 0.17
124 0.16
125 0.12
126 0.11
127 0.1
128 0.08
129 0.07
130 0.07
131 0.07
132 0.09
133 0.09
134 0.09
135 0.1
136 0.11
137 0.14
138 0.2
139 0.21
140 0.23
141 0.3
142 0.31
143 0.31
144 0.31
145 0.27
146 0.22
147 0.2
148 0.18
149 0.11
150 0.1
151 0.1
152 0.09
153 0.09
154 0.08
155 0.08
156 0.06
157 0.05
158 0.06
159 0.09
160 0.09
161 0.09
162 0.11
163 0.13
164 0.17
165 0.18
166 0.2
167 0.19
168 0.2
169 0.21
170 0.22
171 0.2
172 0.21
173 0.2
174 0.2
175 0.18
176 0.17
177 0.17
178 0.18
179 0.22
180 0.2
181 0.2
182 0.19
183 0.2
184 0.25
185 0.25
186 0.3
187 0.32
188 0.29
189 0.29
190 0.29
191 0.27
192 0.22
193 0.21
194 0.16
195 0.12
196 0.13
197 0.16
198 0.18
199 0.18
200 0.25
201 0.25
202 0.25
203 0.25
204 0.26
205 0.31
206 0.36
207 0.43
208 0.38
209 0.43
210 0.43
211 0.44
212 0.44
213 0.37
214 0.31
215 0.24
216 0.23
217 0.16
218 0.15
219 0.17
220 0.18
221 0.19
222 0.16
223 0.16
224 0.18
225 0.2
226 0.24
227 0.24
228 0.23
229 0.26
230 0.31
231 0.34
232 0.33
233 0.34
234 0.31
235 0.31
236 0.35
237 0.35
238 0.3
239 0.3
240 0.35
241 0.39
242 0.41
243 0.43
244 0.38
245 0.34
246 0.38
247 0.41
248 0.4
249 0.41
250 0.46
251 0.45
252 0.47
253 0.51
254 0.52
255 0.48
256 0.49
257 0.42
258 0.35
259 0.37
260 0.42
261 0.46
262 0.5
263 0.58
264 0.63
265 0.7
266 0.77
267 0.82
268 0.84
269 0.87
270 0.88
271 0.88
272 0.87
273 0.86
274 0.81
275 0.76
276 0.72
277 0.67
278 0.61
279 0.53
280 0.49
281 0.41
282 0.38
283 0.37
284 0.34
285 0.32
286 0.29
287 0.26
288 0.23
289 0.25
290 0.26
291 0.22
292 0.22
293 0.21
294 0.23
295 0.31
296 0.3
297 0.32
298 0.34
299 0.33
300 0.33
301 0.35
302 0.35
303 0.33
304 0.36
305 0.38
306 0.36