Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2EKB4

Protein Details
Accession A0A0D2EKB4   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-66LSGSARRLKSPGNKRKRRKATDEADEVHHydrophilic
NLS Segment(s)
PositionSequence
44-57RRLKSPGNKRKRRK
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007224  TIF_Rrn11  
Gene Ontology GO:0001164  F:RNA polymerase I core promoter sequence-specific DNA binding  
GO:0001181  F:RNA polymerase I general transcription initiation factor activity  
Pfam View protein in Pfam  
PF04090  RNA_pol_I_TF  
Amino Acid Sequences MHTTSSGPSIRGRASVSPVLNVSYSMSTIFTPPVGSQSLSGSARRLKSPGNKRKRRKATDEADEVHEQDEAADIQNPAHKIADVEYTAVVSPMARHQRRVAGQPLDQPPPSLPFPHAQTSSTGKEKDFARSRLSTAPRSQYAEAPRSLHLQHLAALTAIVHRSLFEEDFSRASRALGLLFRDASIRRSVAVRNQGYMGIGAEVLLRQGSITRPASGSTSASFPFAREGFENAKRFYERLIVKHPYHKSWPGSVNAVDFYLALFNIWIYVVHAEHNAEVPVPPRTESPPGSPQLLPSLERADVRSEQKVRELEEAEEIAARMDTCMASLPYKDEPELIRLRAMVALWIADLHEVMARIAPAHVEVSDPDFSDLSLQLPLVDEGQSWPLDHSHEATKARVLAEELLARLEYATDPDEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.36
4 0.34
5 0.34
6 0.32
7 0.29
8 0.26
9 0.22
10 0.16
11 0.15
12 0.13
13 0.13
14 0.12
15 0.13
16 0.14
17 0.12
18 0.12
19 0.12
20 0.15
21 0.16
22 0.16
23 0.15
24 0.17
25 0.22
26 0.23
27 0.24
28 0.25
29 0.29
30 0.32
31 0.33
32 0.33
33 0.35
34 0.43
35 0.54
36 0.61
37 0.66
38 0.73
39 0.81
40 0.9
41 0.93
42 0.93
43 0.91
44 0.9
45 0.89
46 0.88
47 0.85
48 0.78
49 0.72
50 0.64
51 0.55
52 0.45
53 0.35
54 0.25
55 0.16
56 0.14
57 0.09
58 0.09
59 0.1
60 0.1
61 0.11
62 0.15
63 0.16
64 0.15
65 0.15
66 0.14
67 0.13
68 0.14
69 0.18
70 0.15
71 0.15
72 0.14
73 0.14
74 0.14
75 0.13
76 0.11
77 0.07
78 0.07
79 0.14
80 0.24
81 0.25
82 0.28
83 0.31
84 0.39
85 0.42
86 0.47
87 0.48
88 0.43
89 0.45
90 0.5
91 0.52
92 0.49
93 0.45
94 0.4
95 0.33
96 0.32
97 0.31
98 0.24
99 0.21
100 0.2
101 0.24
102 0.29
103 0.29
104 0.25
105 0.27
106 0.31
107 0.34
108 0.35
109 0.32
110 0.27
111 0.3
112 0.31
113 0.37
114 0.39
115 0.38
116 0.39
117 0.39
118 0.42
119 0.45
120 0.48
121 0.44
122 0.42
123 0.45
124 0.42
125 0.45
126 0.43
127 0.4
128 0.41
129 0.4
130 0.37
131 0.33
132 0.31
133 0.3
134 0.29
135 0.25
136 0.21
137 0.17
138 0.17
139 0.15
140 0.14
141 0.11
142 0.11
143 0.09
144 0.08
145 0.08
146 0.06
147 0.05
148 0.05
149 0.07
150 0.08
151 0.09
152 0.08
153 0.1
154 0.11
155 0.13
156 0.14
157 0.13
158 0.12
159 0.12
160 0.11
161 0.1
162 0.1
163 0.1
164 0.1
165 0.1
166 0.1
167 0.11
168 0.12
169 0.12
170 0.12
171 0.12
172 0.11
173 0.11
174 0.12
175 0.14
176 0.18
177 0.26
178 0.25
179 0.24
180 0.24
181 0.24
182 0.22
183 0.21
184 0.16
185 0.07
186 0.06
187 0.05
188 0.04
189 0.04
190 0.04
191 0.03
192 0.03
193 0.03
194 0.04
195 0.04
196 0.09
197 0.1
198 0.11
199 0.12
200 0.12
201 0.14
202 0.14
203 0.14
204 0.1
205 0.11
206 0.1
207 0.12
208 0.11
209 0.1
210 0.12
211 0.11
212 0.12
213 0.1
214 0.13
215 0.17
216 0.24
217 0.26
218 0.25
219 0.27
220 0.26
221 0.26
222 0.23
223 0.26
224 0.22
225 0.24
226 0.3
227 0.34
228 0.35
229 0.43
230 0.45
231 0.41
232 0.43
233 0.46
234 0.41
235 0.4
236 0.42
237 0.36
238 0.36
239 0.33
240 0.29
241 0.23
242 0.21
243 0.15
244 0.11
245 0.09
246 0.07
247 0.06
248 0.04
249 0.04
250 0.03
251 0.04
252 0.04
253 0.04
254 0.04
255 0.05
256 0.06
257 0.06
258 0.07
259 0.08
260 0.08
261 0.09
262 0.08
263 0.07
264 0.08
265 0.09
266 0.11
267 0.12
268 0.12
269 0.13
270 0.17
271 0.22
272 0.24
273 0.28
274 0.31
275 0.33
276 0.35
277 0.34
278 0.31
279 0.31
280 0.31
281 0.26
282 0.21
283 0.22
284 0.2
285 0.2
286 0.21
287 0.2
288 0.23
289 0.25
290 0.31
291 0.31
292 0.31
293 0.36
294 0.37
295 0.36
296 0.36
297 0.34
298 0.28
299 0.27
300 0.26
301 0.21
302 0.19
303 0.16
304 0.11
305 0.1
306 0.09
307 0.06
308 0.06
309 0.06
310 0.05
311 0.08
312 0.09
313 0.09
314 0.1
315 0.13
316 0.16
317 0.18
318 0.18
319 0.19
320 0.19
321 0.25
322 0.29
323 0.26
324 0.24
325 0.23
326 0.23
327 0.21
328 0.2
329 0.14
330 0.1
331 0.09
332 0.08
333 0.08
334 0.07
335 0.06
336 0.06
337 0.05
338 0.06
339 0.06
340 0.07
341 0.08
342 0.07
343 0.08
344 0.08
345 0.08
346 0.08
347 0.08
348 0.08
349 0.08
350 0.09
351 0.13
352 0.14
353 0.14
354 0.15
355 0.14
356 0.14
357 0.15
358 0.15
359 0.12
360 0.11
361 0.1
362 0.09
363 0.1
364 0.11
365 0.1
366 0.1
367 0.09
368 0.1
369 0.13
370 0.13
371 0.13
372 0.13
373 0.14
374 0.16
375 0.17
376 0.18
377 0.21
378 0.26
379 0.28
380 0.29
381 0.32
382 0.32
383 0.31
384 0.29
385 0.26
386 0.22
387 0.24
388 0.25
389 0.21
390 0.2
391 0.19
392 0.18
393 0.15
394 0.14
395 0.11
396 0.11
397 0.12