Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2ET00

Protein Details
Accession A0A0D2ET00    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
130-154SEDSDSQPPKKKRRISHDKDEPQYPHydrophilic
NLS Segment(s)
PositionSequence
140-142KKR
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007902  Chl4/mis15/CENP-N  
Gene Ontology GO:0034080  P:CENP-A containing chromatin assembly  
GO:0007059  P:chromosome segregation  
Pfam View protein in Pfam  
PF05238  CENP-N  
Amino Acid Sequences MAPALSKALNRLSRDSLVGLAIKWLSDDRTSTPYLLNNRRLFEADEEDYLYTPAQSTEELRTIYRKLQNDVNLASKQDIIDRIVDGDWRRGLSLHQLATVDFAYLEQNDTALRWTALRLVLPDSARDSLSEDSDSQPPKKKRRISHDKDEPQYPQISAQSFVSALKAEISPLVKAHYHVHKMPSPHDLHIVRLHILPDSTFGGHRSTIPRRAKHATDAGRVMYIALPDSCPYVYVSLSGASGSSVRGKGTRDSKGRVMAKVDMAAMKKIVLEAIPKALSRPQQRWALDSTKLNARSLRSILELRGNQKPGSGGGAYSKFVGKDGVIEMNEIEVPGAEEEDRQRQSAVQQRFGSMEGQHHAALDRVHVKLNKAIQGDERITTGPSGPETSDIALTFTGTDVFQGLKQLAKLGPTYIDLDKLPAWMAGELGLSSMTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.32
4 0.29
5 0.26
6 0.21
7 0.19
8 0.17
9 0.15
10 0.15
11 0.15
12 0.14
13 0.15
14 0.18
15 0.18
16 0.23
17 0.25
18 0.26
19 0.27
20 0.3
21 0.38
22 0.45
23 0.51
24 0.51
25 0.51
26 0.52
27 0.51
28 0.48
29 0.43
30 0.4
31 0.33
32 0.3
33 0.29
34 0.27
35 0.25
36 0.23
37 0.19
38 0.12
39 0.1
40 0.09
41 0.09
42 0.09
43 0.12
44 0.15
45 0.19
46 0.2
47 0.21
48 0.24
49 0.26
50 0.33
51 0.37
52 0.36
53 0.36
54 0.42
55 0.46
56 0.48
57 0.48
58 0.46
59 0.41
60 0.38
61 0.36
62 0.3
63 0.24
64 0.22
65 0.21
66 0.17
67 0.17
68 0.16
69 0.16
70 0.16
71 0.19
72 0.17
73 0.2
74 0.2
75 0.19
76 0.19
77 0.18
78 0.18
79 0.23
80 0.27
81 0.23
82 0.24
83 0.24
84 0.23
85 0.25
86 0.24
87 0.15
88 0.1
89 0.09
90 0.08
91 0.08
92 0.1
93 0.07
94 0.08
95 0.07
96 0.08
97 0.09
98 0.09
99 0.09
100 0.08
101 0.08
102 0.11
103 0.13
104 0.13
105 0.13
106 0.14
107 0.18
108 0.18
109 0.19
110 0.18
111 0.18
112 0.17
113 0.17
114 0.17
115 0.14
116 0.15
117 0.16
118 0.14
119 0.15
120 0.21
121 0.24
122 0.25
123 0.33
124 0.4
125 0.48
126 0.56
127 0.62
128 0.65
129 0.73
130 0.81
131 0.8
132 0.83
133 0.85
134 0.84
135 0.8
136 0.76
137 0.67
138 0.58
139 0.51
140 0.4
141 0.32
142 0.26
143 0.23
144 0.19
145 0.17
146 0.15
147 0.14
148 0.13
149 0.11
150 0.09
151 0.08
152 0.08
153 0.07
154 0.07
155 0.09
156 0.09
157 0.09
158 0.09
159 0.11
160 0.1
161 0.12
162 0.17
163 0.21
164 0.24
165 0.26
166 0.3
167 0.31
168 0.33
169 0.33
170 0.35
171 0.32
172 0.29
173 0.33
174 0.29
175 0.29
176 0.3
177 0.29
178 0.22
179 0.21
180 0.2
181 0.14
182 0.14
183 0.11
184 0.1
185 0.09
186 0.09
187 0.08
188 0.09
189 0.1
190 0.1
191 0.12
192 0.16
193 0.19
194 0.28
195 0.35
196 0.36
197 0.41
198 0.45
199 0.44
200 0.43
201 0.46
202 0.41
203 0.38
204 0.37
205 0.32
206 0.27
207 0.25
208 0.21
209 0.14
210 0.1
211 0.07
212 0.06
213 0.06
214 0.06
215 0.07
216 0.06
217 0.06
218 0.06
219 0.07
220 0.07
221 0.07
222 0.07
223 0.07
224 0.07
225 0.06
226 0.06
227 0.05
228 0.05
229 0.05
230 0.07
231 0.07
232 0.08
233 0.1
234 0.11
235 0.17
236 0.22
237 0.29
238 0.31
239 0.35
240 0.38
241 0.44
242 0.46
243 0.42
244 0.39
245 0.33
246 0.3
247 0.27
248 0.24
249 0.19
250 0.17
251 0.16
252 0.13
253 0.11
254 0.1
255 0.09
256 0.09
257 0.06
258 0.07
259 0.07
260 0.1
261 0.11
262 0.11
263 0.12
264 0.16
265 0.22
266 0.26
267 0.29
268 0.32
269 0.39
270 0.39
271 0.41
272 0.42
273 0.4
274 0.38
275 0.37
276 0.34
277 0.33
278 0.34
279 0.33
280 0.31
281 0.29
282 0.29
283 0.28
284 0.26
285 0.22
286 0.23
287 0.23
288 0.28
289 0.29
290 0.29
291 0.34
292 0.34
293 0.31
294 0.3
295 0.29
296 0.22
297 0.22
298 0.19
299 0.13
300 0.15
301 0.17
302 0.17
303 0.17
304 0.18
305 0.14
306 0.14
307 0.15
308 0.1
309 0.1
310 0.12
311 0.14
312 0.13
313 0.14
314 0.13
315 0.13
316 0.13
317 0.11
318 0.09
319 0.05
320 0.06
321 0.05
322 0.06
323 0.05
324 0.07
325 0.1
326 0.18
327 0.19
328 0.19
329 0.19
330 0.2
331 0.27
332 0.34
333 0.37
334 0.38
335 0.38
336 0.38
337 0.39
338 0.39
339 0.35
340 0.28
341 0.26
342 0.2
343 0.21
344 0.2
345 0.19
346 0.18
347 0.18
348 0.16
349 0.17
350 0.19
351 0.17
352 0.23
353 0.24
354 0.26
355 0.3
356 0.35
357 0.36
358 0.33
359 0.34
360 0.33
361 0.38
362 0.38
363 0.33
364 0.3
365 0.25
366 0.24
367 0.23
368 0.2
369 0.15
370 0.15
371 0.16
372 0.15
373 0.16
374 0.17
375 0.17
376 0.18
377 0.16
378 0.15
379 0.13
380 0.13
381 0.11
382 0.1
383 0.09
384 0.07
385 0.07
386 0.07
387 0.08
388 0.09
389 0.11
390 0.12
391 0.13
392 0.14
393 0.18
394 0.18
395 0.19
396 0.2
397 0.19
398 0.2
399 0.19
400 0.23
401 0.2
402 0.22
403 0.2
404 0.22
405 0.21
406 0.2
407 0.19
408 0.15
409 0.16
410 0.13
411 0.13
412 0.11
413 0.11
414 0.09
415 0.09