Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2EXK5

Protein Details
Accession A0A0D2EXK5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
64-91DYDYDYRHIRRRRHCCRPRVTFNNYIYRHydrophilic
NLS Segment(s)
PositionSequence
42-47RRRRRR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.833, cyto 6, cyto_mito 4.833, mito 2.5
Family & Domain DBs
Amino Acid Sequences MDFMDFFGGHRVMLGQRGGRHDPAMMFYGPRVRLAALAIPERRRRRRPAHIIYDDYDSDSDDSDYDYDYRHIRRRRHCCRPRVTFNNYIYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.19
4 0.25
5 0.29
6 0.28
7 0.28
8 0.26
9 0.24
10 0.23
11 0.23
12 0.17
13 0.14
14 0.14
15 0.19
16 0.18
17 0.18
18 0.16
19 0.13
20 0.13
21 0.14
22 0.15
23 0.12
24 0.16
25 0.18
26 0.23
27 0.3
28 0.38
29 0.45
30 0.49
31 0.55
32 0.59
33 0.67
34 0.73
35 0.74
36 0.76
37 0.73
38 0.7
39 0.64
40 0.59
41 0.48
42 0.39
43 0.3
44 0.2
45 0.15
46 0.12
47 0.1
48 0.07
49 0.07
50 0.07
51 0.08
52 0.07
53 0.08
54 0.1
55 0.14
56 0.19
57 0.27
58 0.35
59 0.43
60 0.53
61 0.63
62 0.72
63 0.8
64 0.84
65 0.85
66 0.88
67 0.9
68 0.9
69 0.88
70 0.85
71 0.83