Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2D3Y2

Protein Details
Accession A0A0D2D3Y2   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
282-309KQRMRKIYSTGRQQKMRKSKSQTFLLQRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036887  HTH_APSES_sf  
IPR018004  KilA/APSES_HTH  
IPR003163  Tscrpt_reg_HTH_APSES-type  
Gene Ontology GO:0003677  F:DNA binding  
GO:0048315  P:conidium formation  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
PROSITE View protein in PROSITE  
PS51299  HTH_APSES  
Amino Acid Sequences MPPYRAIKEDWSDYDDESDLEIYEPEQERVPGSSAQNHVDDRSDDHRSDHDVEGKVQEPIHESLEQASSDESIDSTGMRSWSGGRDVCFEQGPAKDEDHRSQHSLQRKCQDGLPAKTEEWIELSGSDEEAPDVQDMAQKSVSWVEAAKLQTDVGKVYSIIRRDVPVLEMRVRGRKVMRRQIDSWLNAGQILRVAELTDGDRNKAIRTLRAAMPGGFETVNGGDWLYQGTWVPYESGRELARQFGVEQILLPLLECEYSSGAVRGTGQRVKSSANSGKDSVRKQRMRKIYSTGRQQKMRKSKSQTFLLQRLVNMSGPAAATVKTRFLPSVLFACT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.3
3 0.24
4 0.19
5 0.16
6 0.13
7 0.11
8 0.11
9 0.08
10 0.15
11 0.16
12 0.16
13 0.17
14 0.17
15 0.18
16 0.2
17 0.22
18 0.2
19 0.22
20 0.27
21 0.29
22 0.32
23 0.34
24 0.33
25 0.32
26 0.3
27 0.28
28 0.27
29 0.29
30 0.31
31 0.28
32 0.29
33 0.3
34 0.33
35 0.36
36 0.34
37 0.35
38 0.32
39 0.33
40 0.35
41 0.33
42 0.3
43 0.26
44 0.23
45 0.2
46 0.2
47 0.22
48 0.19
49 0.18
50 0.18
51 0.2
52 0.19
53 0.15
54 0.14
55 0.11
56 0.11
57 0.1
58 0.08
59 0.06
60 0.07
61 0.06
62 0.07
63 0.08
64 0.08
65 0.08
66 0.09
67 0.1
68 0.12
69 0.17
70 0.18
71 0.17
72 0.21
73 0.22
74 0.23
75 0.22
76 0.2
77 0.19
78 0.19
79 0.21
80 0.19
81 0.19
82 0.23
83 0.26
84 0.31
85 0.34
86 0.35
87 0.36
88 0.38
89 0.42
90 0.46
91 0.49
92 0.5
93 0.51
94 0.52
95 0.49
96 0.48
97 0.51
98 0.5
99 0.48
100 0.46
101 0.41
102 0.37
103 0.37
104 0.35
105 0.26
106 0.2
107 0.16
108 0.12
109 0.09
110 0.11
111 0.09
112 0.09
113 0.09
114 0.07
115 0.07
116 0.07
117 0.07
118 0.05
119 0.05
120 0.05
121 0.07
122 0.08
123 0.09
124 0.1
125 0.09
126 0.09
127 0.1
128 0.1
129 0.08
130 0.08
131 0.07
132 0.11
133 0.11
134 0.11
135 0.1
136 0.1
137 0.11
138 0.11
139 0.11
140 0.08
141 0.08
142 0.07
143 0.1
144 0.13
145 0.13
146 0.14
147 0.14
148 0.14
149 0.15
150 0.15
151 0.14
152 0.14
153 0.15
154 0.15
155 0.17
156 0.18
157 0.22
158 0.22
159 0.23
160 0.25
161 0.31
162 0.38
163 0.44
164 0.49
165 0.49
166 0.5
167 0.55
168 0.56
169 0.5
170 0.44
171 0.35
172 0.29
173 0.25
174 0.23
175 0.15
176 0.11
177 0.09
178 0.07
179 0.06
180 0.06
181 0.06
182 0.06
183 0.08
184 0.1
185 0.1
186 0.11
187 0.13
188 0.13
189 0.13
190 0.17
191 0.17
192 0.16
193 0.2
194 0.24
195 0.24
196 0.28
197 0.29
198 0.24
199 0.25
200 0.22
201 0.2
202 0.15
203 0.12
204 0.09
205 0.08
206 0.09
207 0.07
208 0.06
209 0.05
210 0.05
211 0.06
212 0.05
213 0.06
214 0.05
215 0.06
216 0.07
217 0.07
218 0.08
219 0.08
220 0.1
221 0.11
222 0.14
223 0.14
224 0.16
225 0.17
226 0.18
227 0.18
228 0.16
229 0.16
230 0.15
231 0.16
232 0.13
233 0.12
234 0.11
235 0.1
236 0.09
237 0.09
238 0.06
239 0.05
240 0.06
241 0.05
242 0.06
243 0.06
244 0.07
245 0.08
246 0.08
247 0.08
248 0.08
249 0.11
250 0.13
251 0.18
252 0.21
253 0.22
254 0.24
255 0.25
256 0.28
257 0.28
258 0.34
259 0.35
260 0.37
261 0.39
262 0.39
263 0.44
264 0.48
265 0.52
266 0.54
267 0.57
268 0.6
269 0.64
270 0.71
271 0.75
272 0.75
273 0.74
274 0.73
275 0.73
276 0.74
277 0.78
278 0.78
279 0.76
280 0.79
281 0.8
282 0.81
283 0.81
284 0.81
285 0.8
286 0.79
287 0.8
288 0.8
289 0.82
290 0.81
291 0.79
292 0.77
293 0.75
294 0.68
295 0.59
296 0.54
297 0.47
298 0.39
299 0.3
300 0.23
301 0.17
302 0.15
303 0.15
304 0.13
305 0.11
306 0.13
307 0.14
308 0.18
309 0.18
310 0.2
311 0.19
312 0.19
313 0.21
314 0.22