Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2BKK9

Protein Details
Accession A0A0D2BKK9   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-32EMNGLVRHGRRRRDNRENPTARHBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.166, mito_nucl 10.499, cyto 5.5, cyto_mito 4.999
Family & Domain DBs
Amino Acid Sequences MDEDMMEGGEMNGLVRHGRRRRDNRENPTARHSYIQLWSPHILPQSDQSPLLSPPPESLIRLHPLCHYNFPSIRGERSLAVPFFTLLFRSWREFSSNSDRASSPSTTSWLLLDLINPDLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.21
4 0.27
5 0.36
6 0.47
7 0.57
8 0.67
9 0.77
10 0.84
11 0.84
12 0.88
13 0.86
14 0.8
15 0.77
16 0.71
17 0.61
18 0.52
19 0.44
20 0.37
21 0.33
22 0.35
23 0.29
24 0.28
25 0.27
26 0.26
27 0.26
28 0.24
29 0.21
30 0.16
31 0.18
32 0.16
33 0.16
34 0.16
35 0.14
36 0.14
37 0.14
38 0.16
39 0.13
40 0.11
41 0.1
42 0.14
43 0.14
44 0.13
45 0.14
46 0.14
47 0.18
48 0.18
49 0.19
50 0.18
51 0.2
52 0.21
53 0.23
54 0.23
55 0.23
56 0.24
57 0.26
58 0.29
59 0.27
60 0.28
61 0.25
62 0.24
63 0.21
64 0.22
65 0.23
66 0.18
67 0.17
68 0.16
69 0.14
70 0.14
71 0.13
72 0.11
73 0.09
74 0.12
75 0.13
76 0.17
77 0.18
78 0.19
79 0.23
80 0.23
81 0.29
82 0.36
83 0.39
84 0.36
85 0.38
86 0.37
87 0.35
88 0.38
89 0.33
90 0.26
91 0.23
92 0.24
93 0.23
94 0.23
95 0.2
96 0.18
97 0.17
98 0.14
99 0.14
100 0.13