Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2FE39

Protein Details
Accession A0A0D2FE39   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
239-270LETNPMMDKEKKKRRNRHKKVVHSKHKYTVLRBasic
NLS Segment(s)
PositionSequence
247-263KEKKKRRNRHKKVVHSK
Subcellular Location(s) mito 16.5, mito_nucl 12.833, nucl 8, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
Amino Acid Sequences MCRICGRMIKCIFDSMPSRALSGTTTRTVRRPQQTRSHHVSSRSLLQSALNLSSKPSRPAAFLLPFHSRGLHQAATQQSGSPSHDFHNTQAEIPPTTLLDGPGNVSTSSTFESPQPPSTTVLTPSSSSTHSLSRPLVLSHSLQTLLPRLTAQKPHYIVSHIHRFPYLLTEGDILRLPFHMHGVSPGDVLRFNRASILGSRDYTLKAGAKNTESYDAKRTGEPQYIDERLFECRMRVMGLETNPMMDKEKKKRRNRHKKVVHSKHKYTVLRVMQIKVKNIDELKTEKGMLVLEGPEGDHQQQTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.35
3 0.37
4 0.32
5 0.31
6 0.26
7 0.27
8 0.23
9 0.24
10 0.24
11 0.24
12 0.28
13 0.3
14 0.36
15 0.44
16 0.51
17 0.57
18 0.6
19 0.63
20 0.7
21 0.76
22 0.79
23 0.79
24 0.78
25 0.72
26 0.69
27 0.66
28 0.59
29 0.58
30 0.52
31 0.44
32 0.37
33 0.33
34 0.3
35 0.27
36 0.27
37 0.19
38 0.17
39 0.19
40 0.25
41 0.27
42 0.28
43 0.3
44 0.27
45 0.28
46 0.31
47 0.35
48 0.34
49 0.34
50 0.35
51 0.36
52 0.37
53 0.35
54 0.33
55 0.26
56 0.24
57 0.27
58 0.23
59 0.19
60 0.22
61 0.24
62 0.26
63 0.26
64 0.23
65 0.2
66 0.2
67 0.23
68 0.19
69 0.18
70 0.17
71 0.22
72 0.22
73 0.22
74 0.28
75 0.26
76 0.25
77 0.27
78 0.26
79 0.22
80 0.21
81 0.2
82 0.12
83 0.13
84 0.12
85 0.1
86 0.09
87 0.08
88 0.09
89 0.1
90 0.11
91 0.09
92 0.09
93 0.08
94 0.09
95 0.11
96 0.1
97 0.1
98 0.1
99 0.15
100 0.17
101 0.2
102 0.21
103 0.21
104 0.22
105 0.24
106 0.24
107 0.22
108 0.22
109 0.19
110 0.18
111 0.18
112 0.17
113 0.16
114 0.17
115 0.16
116 0.16
117 0.16
118 0.18
119 0.17
120 0.17
121 0.17
122 0.15
123 0.15
124 0.14
125 0.14
126 0.12
127 0.12
128 0.11
129 0.11
130 0.11
131 0.12
132 0.1
133 0.1
134 0.09
135 0.11
136 0.13
137 0.19
138 0.2
139 0.24
140 0.25
141 0.26
142 0.26
143 0.26
144 0.26
145 0.26
146 0.34
147 0.28
148 0.27
149 0.26
150 0.25
151 0.23
152 0.24
153 0.19
154 0.1
155 0.1
156 0.11
157 0.11
158 0.11
159 0.12
160 0.09
161 0.08
162 0.08
163 0.08
164 0.07
165 0.08
166 0.07
167 0.07
168 0.08
169 0.11
170 0.11
171 0.1
172 0.11
173 0.1
174 0.11
175 0.12
176 0.15
177 0.13
178 0.13
179 0.13
180 0.13
181 0.14
182 0.14
183 0.19
184 0.16
185 0.16
186 0.17
187 0.17
188 0.17
189 0.16
190 0.17
191 0.15
192 0.15
193 0.17
194 0.19
195 0.2
196 0.21
197 0.22
198 0.27
199 0.26
200 0.27
201 0.3
202 0.3
203 0.29
204 0.28
205 0.3
206 0.28
207 0.32
208 0.31
209 0.29
210 0.32
211 0.33
212 0.32
213 0.3
214 0.27
215 0.24
216 0.26
217 0.23
218 0.17
219 0.16
220 0.16
221 0.16
222 0.16
223 0.15
224 0.18
225 0.19
226 0.22
227 0.2
228 0.21
229 0.2
230 0.21
231 0.22
232 0.23
233 0.31
234 0.38
235 0.49
236 0.58
237 0.69
238 0.79
239 0.86
240 0.91
241 0.93
242 0.94
243 0.94
244 0.95
245 0.96
246 0.96
247 0.96
248 0.94
249 0.9
250 0.88
251 0.86
252 0.79
253 0.72
254 0.7
255 0.65
256 0.64
257 0.6
258 0.56
259 0.53
260 0.54
261 0.54
262 0.49
263 0.45
264 0.43
265 0.41
266 0.39
267 0.37
268 0.37
269 0.36
270 0.34
271 0.33
272 0.27
273 0.26
274 0.24
275 0.19
276 0.18
277 0.14
278 0.12
279 0.11
280 0.12
281 0.12
282 0.15
283 0.16