Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2EY94

Protein Details
Accession A0A0D2EY94   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-126DLRPKQTRAIRRRLSKKDASRTTEKQKKRSTHFPQRKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
87-116RPKQTRAIRRRLSKKDASRTTEKQKKRSTH
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTNARVKPGQLWSKGRDDLKKQLDELKTELGQLRVQKIAGGASSKLNRIHDLRKSIARVLTVINANQRHQLRLFYAKKKYLPLDLRPKQTRAIRRRLSKKDASRTTEKQKKRSTHFPQRKYAVKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.6
4 0.59
5 0.57
6 0.59
7 0.6
8 0.58
9 0.53
10 0.55
11 0.52
12 0.47
13 0.44
14 0.39
15 0.31
16 0.3
17 0.3
18 0.24
19 0.24
20 0.24
21 0.23
22 0.2
23 0.19
24 0.18
25 0.16
26 0.15
27 0.13
28 0.12
29 0.11
30 0.14
31 0.16
32 0.18
33 0.2
34 0.2
35 0.22
36 0.24
37 0.29
38 0.29
39 0.33
40 0.33
41 0.34
42 0.35
43 0.35
44 0.32
45 0.27
46 0.22
47 0.18
48 0.18
49 0.15
50 0.14
51 0.17
52 0.17
53 0.17
54 0.22
55 0.22
56 0.2
57 0.2
58 0.21
59 0.19
60 0.27
61 0.33
62 0.34
63 0.4
64 0.43
65 0.44
66 0.47
67 0.47
68 0.46
69 0.45
70 0.47
71 0.52
72 0.54
73 0.61
74 0.61
75 0.61
76 0.59
77 0.6
78 0.62
79 0.59
80 0.64
81 0.63
82 0.69
83 0.78
84 0.8
85 0.81
86 0.81
87 0.82
88 0.82
89 0.82
90 0.79
91 0.77
92 0.76
93 0.79
94 0.79
95 0.77
96 0.76
97 0.77
98 0.79
99 0.79
100 0.82
101 0.81
102 0.83
103 0.86
104 0.85
105 0.85
106 0.84
107 0.84
108 0.8