Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2E2G6

Protein Details
Accession A0A0D2E2G6    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-47GASNTPKSHTRSTKRRRPEEDTSNTYHydrophilic
95-150AEKKLEREKKRIKSIKSKVKALKREKAKEKKKKNKKNKKTKKTKGEKIRQRAIDKABasic
NLS Segment(s)
PositionSequence
97-145KKLEREKKRIKSIKSKVKALKREKAKEKKKKNKKNKKTKKTKGEKIRQR
163-166KPKK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKSLKTPTKTKVARSTPTKSQGASNTPKSHTRSTKRRRPEEDTSNTYSNEDESESSSSSDISRTSKTSETSEIGSRVSSNDVSFDASTTTKITSAEKKLEREKKRIKSIKSKVKALKREKAKEKKKKNKKNKKTKKTKGEKIRQRAIDKANEDIEIYSTPTKKPKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.71
4 0.73
5 0.68
6 0.58
7 0.56
8 0.53
9 0.54
10 0.55
11 0.54
12 0.52
13 0.53
14 0.58
15 0.57
16 0.6
17 0.62
18 0.64
19 0.66
20 0.71
21 0.78
22 0.82
23 0.87
24 0.85
25 0.84
26 0.83
27 0.82
28 0.8
29 0.77
30 0.73
31 0.65
32 0.57
33 0.5
34 0.4
35 0.3
36 0.22
37 0.17
38 0.11
39 0.11
40 0.12
41 0.12
42 0.13
43 0.12
44 0.12
45 0.11
46 0.11
47 0.1
48 0.11
49 0.12
50 0.13
51 0.16
52 0.18
53 0.19
54 0.21
55 0.22
56 0.21
57 0.21
58 0.22
59 0.2
60 0.18
61 0.16
62 0.14
63 0.11
64 0.11
65 0.1
66 0.08
67 0.08
68 0.08
69 0.09
70 0.09
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.08
79 0.11
80 0.15
81 0.18
82 0.25
83 0.28
84 0.32
85 0.41
86 0.5
87 0.53
88 0.58
89 0.65
90 0.66
91 0.74
92 0.77
93 0.75
94 0.76
95 0.81
96 0.81
97 0.78
98 0.78
99 0.75
100 0.77
101 0.8
102 0.77
103 0.76
104 0.75
105 0.79
106 0.81
107 0.83
108 0.85
109 0.86
110 0.89
111 0.91
112 0.93
113 0.94
114 0.95
115 0.95
116 0.95
117 0.96
118 0.96
119 0.96
120 0.97
121 0.96
122 0.96
123 0.96
124 0.95
125 0.95
126 0.94
127 0.93
128 0.92
129 0.91
130 0.88
131 0.81
132 0.79
133 0.74
134 0.72
135 0.64
136 0.58
137 0.51
138 0.43
139 0.39
140 0.31
141 0.27
142 0.19
143 0.2
144 0.2
145 0.2
146 0.23
147 0.32