Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2BSK7

Protein Details
Accession A0A0D2BSK7   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTRKKWLKMRILWKPHRNLLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 13, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013083  Znf_RING/FYVE/PHD  
Amino Acid Sequences MTRKKWLKMRILWKPHRNLLFPRRRTKPSFGDSDLRGKFVQGLIFCSAFCLDEFKLSDLVQKLPQCPHYFHSKCTDEWIKRELEASEKAEIVSALSEPRTPEDTLRTISMPCPLCRRRLREVAVAGISKPEPAHVLNAQRLDSVVVGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.8
4 0.74
5 0.73
6 0.73
7 0.73
8 0.72
9 0.74
10 0.73
11 0.75
12 0.76
13 0.75
14 0.73
15 0.68
16 0.67
17 0.62
18 0.6
19 0.56
20 0.58
21 0.51
22 0.44
23 0.38
24 0.31
25 0.27
26 0.23
27 0.23
28 0.14
29 0.17
30 0.16
31 0.17
32 0.16
33 0.16
34 0.14
35 0.12
36 0.11
37 0.11
38 0.09
39 0.12
40 0.13
41 0.13
42 0.14
43 0.14
44 0.17
45 0.16
46 0.17
47 0.19
48 0.19
49 0.21
50 0.22
51 0.27
52 0.25
53 0.26
54 0.26
55 0.33
56 0.32
57 0.32
58 0.37
59 0.34
60 0.32
61 0.37
62 0.42
63 0.33
64 0.35
65 0.35
66 0.28
67 0.26
68 0.27
69 0.21
70 0.18
71 0.19
72 0.19
73 0.17
74 0.16
75 0.16
76 0.15
77 0.14
78 0.11
79 0.08
80 0.06
81 0.05
82 0.06
83 0.07
84 0.07
85 0.1
86 0.13
87 0.13
88 0.14
89 0.18
90 0.2
91 0.21
92 0.22
93 0.21
94 0.18
95 0.19
96 0.24
97 0.23
98 0.23
99 0.3
100 0.31
101 0.39
102 0.46
103 0.52
104 0.53
105 0.59
106 0.61
107 0.6
108 0.6
109 0.56
110 0.52
111 0.47
112 0.39
113 0.33
114 0.28
115 0.22
116 0.19
117 0.14
118 0.13
119 0.13
120 0.18
121 0.2
122 0.27
123 0.31
124 0.34
125 0.33
126 0.31
127 0.3
128 0.27
129 0.22