Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2EBV1

Protein Details
Accession A0A0D2EBV1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
330-358ITGPVGPHNVRRRDKRRGLGRLTPKLRHRBasic
NLS Segment(s)
PositionSequence
340-357RRRDKRRGLGRLTPKLRH
Subcellular Location(s) plas 24, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023041  Glucose_rcpt_Git3_N  
IPR022596  GPR1_C  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF11710  Git3  
PF11970  GPR_Gpa2_C  
CDD cd00637  7tm_classA_rhodopsin-like  
Amino Acid Sequences MTSNSSVSLSTTLDPLPPVLQRGLVAVAFFGILSLVTSLGLFTFLTYRLCVWKVKGQLQDGPNQFLILIYNLVLADIQQAISFSLTSAYLAAGKIEVGTTTCWANGWFVSVGDLASGVFIFAIALHTFFAVVKSRRPSSRVFYSCIGGAWIFVYAMAIIGVGIDAKLYVRAGAWCWISHDHDAERLWLHYFWIFICMFGTVFVYALILLSIQTRSRIWSHQRTPTQESDPAVLKRAAKYMIIYPVVYVICTLPLAGARMASMRGMVVPYWWFCLAGSAITSCGWLDVLLYAMTRRVLIFNHDPPPPDDIGLDTIGWKHSGEGFWGTTTTITGPVGPHNVRRRDKRRGLGRLTPKLRHRHSDEDHLANHPEGVIAAKTTVEIQTCSVPQYAESTELSVMDGDDKIERAHSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.17
5 0.19
6 0.18
7 0.18
8 0.17
9 0.18
10 0.19
11 0.17
12 0.15
13 0.11
14 0.11
15 0.09
16 0.09
17 0.07
18 0.04
19 0.04
20 0.04
21 0.05
22 0.04
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.05
29 0.05
30 0.07
31 0.08
32 0.1
33 0.11
34 0.12
35 0.16
36 0.18
37 0.21
38 0.24
39 0.29
40 0.35
41 0.42
42 0.47
43 0.46
44 0.52
45 0.51
46 0.56
47 0.52
48 0.49
49 0.42
50 0.36
51 0.31
52 0.24
53 0.22
54 0.14
55 0.12
56 0.07
57 0.08
58 0.08
59 0.08
60 0.07
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.06
86 0.07
87 0.08
88 0.08
89 0.08
90 0.08
91 0.09
92 0.08
93 0.1
94 0.09
95 0.09
96 0.1
97 0.1
98 0.09
99 0.08
100 0.08
101 0.05
102 0.05
103 0.05
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.05
110 0.04
111 0.05
112 0.05
113 0.05
114 0.06
115 0.06
116 0.08
117 0.12
118 0.13
119 0.18
120 0.24
121 0.29
122 0.31
123 0.34
124 0.37
125 0.38
126 0.47
127 0.45
128 0.44
129 0.41
130 0.39
131 0.37
132 0.32
133 0.26
134 0.16
135 0.12
136 0.08
137 0.07
138 0.05
139 0.05
140 0.05
141 0.03
142 0.03
143 0.03
144 0.03
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.03
154 0.03
155 0.03
156 0.04
157 0.05
158 0.06
159 0.09
160 0.1
161 0.1
162 0.12
163 0.14
164 0.16
165 0.17
166 0.17
167 0.15
168 0.16
169 0.16
170 0.16
171 0.14
172 0.12
173 0.13
174 0.11
175 0.11
176 0.09
177 0.09
178 0.08
179 0.11
180 0.1
181 0.09
182 0.09
183 0.08
184 0.08
185 0.08
186 0.08
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.04
198 0.04
199 0.06
200 0.06
201 0.08
202 0.1
203 0.16
204 0.23
205 0.31
206 0.37
207 0.44
208 0.49
209 0.53
210 0.56
211 0.55
212 0.51
213 0.44
214 0.4
215 0.34
216 0.33
217 0.28
218 0.25
219 0.23
220 0.21
221 0.19
222 0.21
223 0.19
224 0.15
225 0.16
226 0.17
227 0.19
228 0.19
229 0.18
230 0.15
231 0.17
232 0.16
233 0.15
234 0.12
235 0.07
236 0.07
237 0.07
238 0.07
239 0.04
240 0.05
241 0.06
242 0.06
243 0.06
244 0.06
245 0.06
246 0.07
247 0.06
248 0.06
249 0.05
250 0.05
251 0.06
252 0.05
253 0.06
254 0.07
255 0.08
256 0.1
257 0.1
258 0.1
259 0.09
260 0.11
261 0.1
262 0.09
263 0.09
264 0.07
265 0.08
266 0.08
267 0.08
268 0.06
269 0.06
270 0.05
271 0.05
272 0.05
273 0.04
274 0.05
275 0.05
276 0.05
277 0.05
278 0.06
279 0.07
280 0.07
281 0.07
282 0.08
283 0.08
284 0.14
285 0.21
286 0.26
287 0.3
288 0.31
289 0.33
290 0.33
291 0.37
292 0.31
293 0.25
294 0.19
295 0.16
296 0.17
297 0.16
298 0.15
299 0.11
300 0.11
301 0.11
302 0.12
303 0.1
304 0.09
305 0.11
306 0.11
307 0.12
308 0.15
309 0.15
310 0.15
311 0.15
312 0.14
313 0.12
314 0.12
315 0.11
316 0.09
317 0.09
318 0.09
319 0.1
320 0.13
321 0.19
322 0.2
323 0.28
324 0.35
325 0.45
326 0.52
327 0.62
328 0.68
329 0.73
330 0.8
331 0.82
332 0.84
333 0.84
334 0.84
335 0.83
336 0.85
337 0.84
338 0.82
339 0.8
340 0.78
341 0.78
342 0.76
343 0.75
344 0.72
345 0.72
346 0.7
347 0.73
348 0.72
349 0.67
350 0.63
351 0.58
352 0.53
353 0.42
354 0.37
355 0.26
356 0.19
357 0.13
358 0.13
359 0.1
360 0.08
361 0.08
362 0.08
363 0.09
364 0.1
365 0.12
366 0.12
367 0.12
368 0.14
369 0.18
370 0.19
371 0.21
372 0.2
373 0.18
374 0.17
375 0.21
376 0.2
377 0.19
378 0.19
379 0.19
380 0.18
381 0.18
382 0.18
383 0.14
384 0.13
385 0.11
386 0.11
387 0.1
388 0.11
389 0.12
390 0.12