Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WVZ7

Protein Details
Accession Q4WVZ7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-34DEILVNRRQNARRRTRRPAASKPGSHydrophilic
NLS Segment(s)
PositionSequence
17-54RQNARRRTRRPAASKPGSAAVPVGGVKKNAKAAKPVAK
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
KEGG afm:AFUA_5G13870  -  
Amino Acid Sequences MSTKLDKSLDEILVNRRQNARRRTRRPAASKPGSAAVPVGGVKKNAKAAKPVAKGAQGGHPVATESKIMVSGLPSDVNEANIKVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.4
4 0.45
5 0.52
6 0.59
7 0.64
8 0.67
9 0.74
10 0.8
11 0.82
12 0.85
13 0.85
14 0.85
15 0.84
16 0.8
17 0.73
18 0.64
19 0.57
20 0.47
21 0.38
22 0.28
23 0.17
24 0.12
25 0.11
26 0.11
27 0.08
28 0.1
29 0.1
30 0.12
31 0.18
32 0.19
33 0.19
34 0.22
35 0.27
36 0.35
37 0.37
38 0.38
39 0.34
40 0.34
41 0.34
42 0.31
43 0.31
44 0.25
45 0.22
46 0.2
47 0.18
48 0.17
49 0.17
50 0.16
51 0.11
52 0.08
53 0.08
54 0.09
55 0.09
56 0.08
57 0.08
58 0.09
59 0.1
60 0.11
61 0.11
62 0.13
63 0.14
64 0.16
65 0.16