Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2EPJ6

Protein Details
Accession A0A0D2EPJ6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
26-48AAEKERRRDEKSRKQEEKKLLESBasic
NLS Segment(s)
PositionSequence
29-58KERRRDEKSRKQEEKKLLESFKKDRRMKSR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSVSGFSVQHDPEVQAYNKLRATYLAAEKERRRDEKSRKQEEKKLLESFKKDRRMKSRTGNRNVVSRILHPVGKDRDERLLPEVMGAKSVDSESDLDEVSLKEALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.28
4 0.31
5 0.32
6 0.31
7 0.29
8 0.25
9 0.28
10 0.26
11 0.3
12 0.32
13 0.33
14 0.39
15 0.42
16 0.5
17 0.53
18 0.52
19 0.52
20 0.55
21 0.62
22 0.67
23 0.74
24 0.77
25 0.8
26 0.82
27 0.84
28 0.84
29 0.8
30 0.75
31 0.71
32 0.65
33 0.59
34 0.58
35 0.57
36 0.56
37 0.58
38 0.56
39 0.57
40 0.61
41 0.61
42 0.62
43 0.65
44 0.68
45 0.68
46 0.71
47 0.72
48 0.65
49 0.66
50 0.61
51 0.54
52 0.45
53 0.36
54 0.34
55 0.28
56 0.27
57 0.21
58 0.28
59 0.28
60 0.31
61 0.31
62 0.28
63 0.32
64 0.32
65 0.33
66 0.29
67 0.27
68 0.23
69 0.23
70 0.26
71 0.19
72 0.2
73 0.18
74 0.15
75 0.13
76 0.13
77 0.11
78 0.09
79 0.09
80 0.09
81 0.11
82 0.11
83 0.1
84 0.11
85 0.11
86 0.11