Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WT37

Protein Details
Accession Q4WT37    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-60DDHLKKIKAVDKVRKEQRRQTVEGBasic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR004908  ATPase_V1-cplx_hsu  
IPR011987  ATPase_V1-cplx_hsu_C  
IPR038497  ATPase_V1-cplx_hsu_C_sf  
Gene Ontology GO:0000329  C:fungal-type vacuole membrane  
GO:0000221  C:vacuolar proton-transporting V-type ATPase, V1 domain  
GO:0016787  F:hydrolase activity  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
KEGG afm:AFUA_1G10670  -  
Pfam View protein in Pfam  
PF11698  V-ATPase_H_C  
PF03224  V-ATPase_H_N  
Amino Acid Sequences MSSTSLEPPTYLSSLQNNIRARPIPWEGAVRAGNITDDHLKKIKAVDKVRKEQRRQTVEGDLQGYVGLLAGNADSKSVLDSASKRTDIVQYILVLATDLISDVPSLSSALIAHPSPYKPFLPLLRHSTNAEDPIPLLTSTFLTRLVSHSLAASTKAAVRDEEALPQLYTYLSTLTQNPDSGLQDIGVQGLSALLRNSRSREMFWNQRKETIDPLIEILRAAAGTKDSSSASTLAGSSRAIEPGLSGGVGLQLLYRVLLVLWQLSFEGSLVGEGLQSDYEFVQLYTQLLRLSPKEKTTRLLLATLNNLLSSNRTTLLPVAVFVRLPALLSNLSGRHLTDPDLLEDLNALSEMLDEYTKTQTTFDQYAAELQSGHLRWSPPHRNPTFWAENARRILDEGNGALPKKLAEILSKSWDNDKQVLAIGCNDVGQLVKEMPERRSQLEKLGLKTRVMELMADKDESVRWESLRAVGEWLRYTFEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.41
4 0.4
5 0.4
6 0.45
7 0.45
8 0.41
9 0.41
10 0.41
11 0.37
12 0.37
13 0.4
14 0.34
15 0.39
16 0.39
17 0.32
18 0.28
19 0.24
20 0.22
21 0.17
22 0.2
23 0.22
24 0.22
25 0.26
26 0.29
27 0.29
28 0.3
29 0.37
30 0.4
31 0.41
32 0.49
33 0.55
34 0.61
35 0.71
36 0.8
37 0.83
38 0.85
39 0.85
40 0.86
41 0.84
42 0.78
43 0.73
44 0.72
45 0.66
46 0.62
47 0.54
48 0.44
49 0.35
50 0.3
51 0.25
52 0.15
53 0.11
54 0.06
55 0.04
56 0.04
57 0.04
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.08
64 0.08
65 0.08
66 0.11
67 0.14
68 0.2
69 0.26
70 0.26
71 0.25
72 0.27
73 0.31
74 0.3
75 0.29
76 0.25
77 0.2
78 0.21
79 0.2
80 0.18
81 0.13
82 0.1
83 0.08
84 0.05
85 0.05
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.08
98 0.08
99 0.1
100 0.13
101 0.14
102 0.16
103 0.2
104 0.19
105 0.19
106 0.23
107 0.28
108 0.31
109 0.36
110 0.42
111 0.41
112 0.43
113 0.42
114 0.43
115 0.39
116 0.36
117 0.31
118 0.23
119 0.2
120 0.18
121 0.18
122 0.14
123 0.11
124 0.08
125 0.09
126 0.1
127 0.1
128 0.1
129 0.09
130 0.1
131 0.12
132 0.15
133 0.15
134 0.14
135 0.14
136 0.14
137 0.14
138 0.14
139 0.12
140 0.09
141 0.11
142 0.13
143 0.13
144 0.12
145 0.12
146 0.15
147 0.15
148 0.17
149 0.16
150 0.16
151 0.15
152 0.14
153 0.13
154 0.09
155 0.09
156 0.07
157 0.07
158 0.06
159 0.08
160 0.1
161 0.12
162 0.14
163 0.13
164 0.14
165 0.15
166 0.15
167 0.15
168 0.13
169 0.1
170 0.1
171 0.09
172 0.09
173 0.07
174 0.05
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.08
182 0.1
183 0.13
184 0.17
185 0.18
186 0.19
187 0.26
188 0.31
189 0.39
190 0.46
191 0.53
192 0.5
193 0.54
194 0.54
195 0.49
196 0.47
197 0.4
198 0.32
199 0.23
200 0.23
201 0.19
202 0.16
203 0.15
204 0.11
205 0.07
206 0.06
207 0.05
208 0.04
209 0.04
210 0.04
211 0.05
212 0.06
213 0.06
214 0.07
215 0.08
216 0.08
217 0.08
218 0.08
219 0.08
220 0.07
221 0.07
222 0.07
223 0.07
224 0.07
225 0.07
226 0.06
227 0.06
228 0.06
229 0.05
230 0.06
231 0.04
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.05
252 0.04
253 0.04
254 0.03
255 0.03
256 0.03
257 0.03
258 0.03
259 0.03
260 0.04
261 0.03
262 0.03
263 0.04
264 0.04
265 0.05
266 0.05
267 0.05
268 0.05
269 0.05
270 0.06
271 0.06
272 0.07
273 0.07
274 0.07
275 0.09
276 0.11
277 0.14
278 0.16
279 0.21
280 0.26
281 0.27
282 0.29
283 0.32
284 0.34
285 0.33
286 0.33
287 0.29
288 0.25
289 0.26
290 0.24
291 0.2
292 0.16
293 0.15
294 0.12
295 0.12
296 0.11
297 0.1
298 0.1
299 0.1
300 0.1
301 0.11
302 0.13
303 0.11
304 0.1
305 0.1
306 0.1
307 0.1
308 0.09
309 0.09
310 0.07
311 0.07
312 0.07
313 0.07
314 0.07
315 0.08
316 0.1
317 0.09
318 0.11
319 0.11
320 0.12
321 0.12
322 0.13
323 0.14
324 0.16
325 0.17
326 0.17
327 0.18
328 0.17
329 0.14
330 0.14
331 0.11
332 0.07
333 0.06
334 0.05
335 0.04
336 0.04
337 0.04
338 0.05
339 0.05
340 0.05
341 0.07
342 0.1
343 0.11
344 0.11
345 0.11
346 0.13
347 0.18
348 0.2
349 0.19
350 0.18
351 0.17
352 0.2
353 0.2
354 0.19
355 0.13
356 0.12
357 0.17
358 0.16
359 0.17
360 0.17
361 0.17
362 0.2
363 0.3
364 0.4
365 0.42
366 0.52
367 0.53
368 0.55
369 0.58
370 0.63
371 0.6
372 0.52
373 0.54
374 0.48
375 0.53
376 0.52
377 0.49
378 0.4
379 0.35
380 0.34
381 0.26
382 0.23
383 0.17
384 0.17
385 0.19
386 0.19
387 0.18
388 0.17
389 0.16
390 0.15
391 0.16
392 0.14
393 0.16
394 0.2
395 0.24
396 0.31
397 0.33
398 0.34
399 0.37
400 0.4
401 0.39
402 0.38
403 0.35
404 0.29
405 0.31
406 0.31
407 0.26
408 0.23
409 0.2
410 0.17
411 0.16
412 0.14
413 0.1
414 0.1
415 0.09
416 0.1
417 0.09
418 0.12
419 0.17
420 0.22
421 0.24
422 0.32
423 0.35
424 0.37
425 0.44
426 0.43
427 0.45
428 0.51
429 0.54
430 0.51
431 0.57
432 0.55
433 0.49
434 0.49
435 0.44
436 0.38
437 0.33
438 0.29
439 0.24
440 0.27
441 0.28
442 0.26
443 0.24
444 0.21
445 0.22
446 0.23
447 0.24
448 0.2
449 0.18
450 0.2
451 0.22
452 0.26
453 0.27
454 0.25
455 0.26
456 0.26
457 0.3
458 0.31
459 0.3