Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2EEL7

Protein Details
Accession A0A0D2EEL7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
118-137RDDPVGRRRRKGKFDPDVIDBasic
NLS Segment(s)
PositionSequence
124-129RRRRKG
Subcellular Location(s) nucl 14, cyto 5.5, plas 5, cyto_mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013262  OMP_MIM1/TOM13_mt  
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
Pfam View protein in Pfam  
PF08219  TOM13  
Amino Acid Sequences MASHSDQSPSPPQDLSGSQLTIPSDSEPFSSLSPPSSSPPQSSDNNGSQPVIIYKPPTFWGILRGAAINLVLPFVNGMMLGFGELLAHEFAFRLGWSGTNVWPRHRGSHPIGPGVEMRDDPVGRRRRKGKFDPDVIDAASLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.24
4 0.22
5 0.2
6 0.22
7 0.21
8 0.18
9 0.18
10 0.15
11 0.13
12 0.12
13 0.13
14 0.12
15 0.13
16 0.13
17 0.14
18 0.13
19 0.14
20 0.15
21 0.16
22 0.18
23 0.23
24 0.24
25 0.24
26 0.27
27 0.3
28 0.3
29 0.34
30 0.36
31 0.33
32 0.34
33 0.33
34 0.29
35 0.24
36 0.23
37 0.2
38 0.15
39 0.12
40 0.13
41 0.12
42 0.13
43 0.15
44 0.15
45 0.15
46 0.13
47 0.16
48 0.15
49 0.15
50 0.14
51 0.13
52 0.12
53 0.11
54 0.1
55 0.07
56 0.05
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.03
73 0.04
74 0.04
75 0.03
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.08
84 0.1
85 0.13
86 0.21
87 0.22
88 0.24
89 0.3
90 0.31
91 0.35
92 0.37
93 0.41
94 0.4
95 0.47
96 0.47
97 0.46
98 0.44
99 0.39
100 0.38
101 0.33
102 0.28
103 0.2
104 0.18
105 0.18
106 0.18
107 0.19
108 0.27
109 0.34
110 0.38
111 0.47
112 0.54
113 0.59
114 0.69
115 0.77
116 0.79
117 0.8
118 0.84
119 0.8
120 0.75
121 0.68
122 0.58