FuNGI

Q4WDE8

Protein Details

Accession

Q4WDE8

Localization Confidence

Low

Confidence Score

9.2

NoLS Segment(s)

Position	Sequence	Protein Nature
439-462	LATSVTTRYKRKVRSPPNSTTFVR	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 17, cyto_nucl 15.5, cyto 8

Family & Domain DBs

InterPro	View protein in InterPro IPR032640 AMPK1_CBM IPR006828 ASC_dom IPR037256 ASC_dom_sf IPR013783 Ig-like_fold IPR014756 Ig_E-set
Gene Ontology	GO:0005737 C:cytoplasm GO:0031588 C:nucleotide-activated protein kinase complex GO:0005634 C:nucleus GO:0016301 F:kinase activity GO:0019901 F:protein kinase binding GO:0016310 P:phosphorylation GO:0000272 P:polysaccharide catabolic process GO:0007165 P:signal transduction
KEGG	afm:AFUA_6G04500 -
Pfam	View protein in Pfam PF16561 AMPK1_CBM PF04739 AMPKBI
CDD	cd02859 E_set_AMPKbeta_like_N

Amino Acid Sequences

MGNNPSKGPSGDAPPSSASSNLSAPAGDKKVNRRPSTNAISGAAKATAADPSASIETATGHSATARQTPVQQRLQSRNITDSSRGNSERHDRHDAKKAEPHYRDIPSPDPSNPVQVPVSRAAARNDATVAPSGPPLNTYYSASTHLQRPPRMPLPIGDATATPGSPIIGPEDSHIGFVSGDRSLGEQASQDNAGITNTAIDDEETLDELEPYTPSGVGRAVPTCIEWNGPGEKVYVTGTFVNWEKKYRLHRNESNPGVMSTTLNLRPGTHHLKFIVDGEMRASDNLPTAVDFTNHLVNYIEVSADDVNQSRRGSDRTNKSAVPSGVHPPQVIPNLIGDDRNGVENQSDKEEPEEIPLGDFQTIIPQFLVDLDKDEDSPEYQQAANVIGDTPTPPSLPLFLGKSILNGTTPMKDDSSVLNYPNHTVLNHLATSSIKNGVLATSVTTRYKRKVRSPPNSTTFVRV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.35
2	0.36
3	0.33
4	0.3
5	0.25
6	0.21
7	0.21
8	0.2
9	0.18
10	0.16
11	0.16
12	0.22
13	0.24
14	0.26
15	0.3
16	0.38
17	0.48
18	0.58
19	0.61
20	0.59
21	0.63
22	0.68
23	0.71
24	0.66
25	0.59
26	0.52
27	0.49
28	0.45
29	0.39
30	0.3
31	0.21
32	0.16
33	0.13
34	0.12
35	0.11
36	0.1
37	0.08
38	0.11
39	0.13
40	0.12
41	0.12
42	0.1
43	0.11
44	0.12
45	0.13
46	0.1
47	0.09
48	0.1
49	0.12
50	0.14
51	0.18
52	0.18
53	0.18
54	0.26
55	0.34
56	0.42
57	0.48
58	0.51
59	0.54
60	0.6
61	0.66
62	0.64
63	0.58
64	0.55
65	0.5
66	0.48
67	0.44
68	0.4
69	0.37
70	0.39
71	0.39
72	0.35
73	0.37
74	0.44
75	0.47
76	0.49
77	0.54
78	0.52
79	0.55
80	0.64
81	0.62
82	0.58
83	0.59
84	0.59
85	0.59
86	0.57
87	0.57
88	0.54
89	0.54
90	0.51
91	0.48
92	0.46
93	0.42
94	0.42
95	0.37
96	0.35
97	0.32
98	0.36
99	0.31
100	0.3
101	0.27
102	0.25
103	0.27
104	0.25
105	0.28
106	0.24
107	0.26
108	0.26
109	0.28
110	0.27
111	0.25
112	0.23
113	0.2
114	0.18
115	0.17
116	0.16
117	0.12
118	0.12
119	0.12
120	0.1
121	0.11
122	0.12
123	0.14
124	0.15
125	0.16
126	0.16
127	0.17
128	0.21
129	0.22
130	0.23
131	0.25
132	0.29
133	0.34
134	0.35
135	0.37
136	0.4
137	0.44
138	0.43
139	0.39
140	0.35
141	0.36
142	0.34
143	0.32
144	0.25
145	0.2
146	0.2
147	0.19
148	0.17
149	0.1
150	0.08
151	0.07
152	0.07
153	0.07
154	0.07
155	0.08
156	0.08
157	0.09
158	0.12
159	0.12
160	0.12
161	0.12
162	0.1
163	0.09
164	0.09
165	0.1
166	0.06
167	0.06
168	0.06
169	0.07
170	0.07
171	0.07
172	0.07
173	0.06
174	0.07
175	0.08
176	0.08
177	0.07
178	0.07
179	0.07
180	0.07
181	0.06
182	0.05
183	0.04
184	0.04
185	0.05
186	0.04
187	0.04
188	0.05
189	0.05
190	0.05
191	0.05
192	0.06
193	0.05
194	0.05
195	0.06
196	0.06
197	0.05
198	0.05
199	0.05
200	0.05
201	0.05
202	0.05
203	0.06
204	0.06
205	0.07
206	0.08
207	0.08
208	0.08
209	0.09
210	0.09
211	0.09
212	0.09
213	0.08
214	0.09
215	0.1
216	0.1
217	0.1
218	0.09
219	0.09
220	0.09
221	0.1
222	0.08
223	0.08
224	0.08
225	0.08
226	0.09
227	0.11
228	0.16
229	0.15
230	0.18
231	0.18
232	0.23
233	0.32
234	0.41
235	0.47
236	0.51
237	0.58
238	0.64
239	0.72
240	0.69
241	0.61
242	0.52
243	0.44
244	0.36
245	0.28
246	0.2
247	0.12
248	0.13
249	0.12
250	0.13
251	0.13
252	0.12
253	0.14
254	0.2
255	0.27
256	0.24
257	0.25
258	0.24
259	0.25
260	0.25
261	0.24
262	0.24
263	0.16
264	0.15
265	0.14
266	0.15
267	0.14
268	0.13
269	0.12
270	0.08
271	0.08
272	0.08
273	0.07
274	0.06
275	0.08
276	0.08
277	0.08
278	0.09
279	0.1
280	0.14
281	0.14
282	0.14
283	0.12
284	0.12
285	0.12
286	0.11
287	0.09
288	0.05
289	0.07
290	0.07
291	0.07
292	0.08
293	0.08
294	0.1
295	0.14
296	0.14
297	0.13
298	0.15
299	0.18
300	0.24
301	0.31
302	0.39
303	0.42
304	0.46
305	0.46
306	0.46
307	0.49
308	0.43
309	0.37
310	0.3
311	0.3
312	0.3
313	0.31
314	0.28
315	0.23
316	0.27
317	0.27
318	0.25
319	0.2
320	0.16
321	0.18
322	0.18
323	0.18
324	0.13
325	0.13
326	0.13
327	0.14
328	0.13
329	0.1
330	0.11
331	0.14
332	0.15
333	0.17
334	0.18
335	0.16
336	0.18
337	0.2
338	0.19
339	0.19
340	0.2
341	0.15
342	0.16
343	0.16
344	0.15
345	0.13
346	0.13
347	0.09
348	0.15
349	0.15
350	0.14
351	0.14
352	0.12
353	0.12
354	0.14
355	0.16
356	0.08
357	0.11
358	0.12
359	0.13
360	0.13
361	0.14
362	0.14
363	0.14
364	0.16
365	0.15
366	0.15
367	0.14
368	0.15
369	0.15
370	0.16
371	0.14
372	0.12
373	0.11
374	0.09
375	0.1
376	0.1
377	0.11
378	0.1
379	0.1
380	0.11
381	0.11
382	0.13
383	0.14
384	0.17
385	0.17
386	0.17
387	0.19
388	0.19
389	0.19
390	0.19
391	0.18
392	0.15
393	0.15
394	0.16
395	0.17
396	0.2
397	0.2
398	0.2
399	0.19
400	0.2
401	0.22
402	0.26
403	0.25
404	0.25
405	0.27
406	0.27
407	0.28
408	0.3
409	0.27
410	0.2
411	0.21
412	0.23
413	0.24
414	0.23
415	0.21
416	0.2
417	0.2
418	0.22
419	0.22
420	0.21
421	0.16
422	0.16
423	0.17
424	0.16
425	0.16
426	0.14
427	0.15
428	0.15
429	0.19
430	0.23
431	0.28
432	0.34
433	0.41
434	0.5
435	0.55
436	0.62
437	0.69
438	0.76
439	0.82
440	0.85
441	0.87
442	0.84
443	0.83

Q4WDE8

3D AlphaFold-predicted Structure Viewer