Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2ERX2

Protein Details
Accession A0A0D2ERX2   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MECYGKRKKSSRKPQGPKKREPLATTHydrophilic
NLS Segment(s)
PositionSequence
6-20KRKKSSRKPQGPKKR
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MECYGKRKKSSRKPQGPKKREPLATTFTCLFCNHERAIQIKLDKKAGVGNLHCKVCGQRFQTGINYLSAAVDVYSDWIDACENVAQEAAAQEAEDQKFSSYATARPGGAAAAGGDDEGEDGDYGGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.96
3 0.95
4 0.94
5 0.92
6 0.9
7 0.84
8 0.77
9 0.73
10 0.69
11 0.61
12 0.55
13 0.48
14 0.4
15 0.35
16 0.31
17 0.29
18 0.25
19 0.27
20 0.23
21 0.23
22 0.24
23 0.24
24 0.26
25 0.25
26 0.28
27 0.29
28 0.31
29 0.31
30 0.29
31 0.28
32 0.28
33 0.27
34 0.26
35 0.23
36 0.27
37 0.3
38 0.3
39 0.29
40 0.27
41 0.27
42 0.25
43 0.29
44 0.25
45 0.24
46 0.25
47 0.27
48 0.29
49 0.29
50 0.27
51 0.2
52 0.18
53 0.14
54 0.12
55 0.1
56 0.07
57 0.05
58 0.04
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.04
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.04
77 0.04
78 0.05
79 0.09
80 0.1
81 0.11
82 0.11
83 0.11
84 0.11
85 0.12
86 0.14
87 0.11
88 0.13
89 0.18
90 0.2
91 0.19
92 0.19
93 0.19
94 0.16
95 0.14
96 0.12
97 0.07
98 0.06
99 0.06
100 0.05
101 0.05
102 0.04
103 0.04
104 0.04
105 0.05
106 0.04