Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2F339

Protein Details
Accession A0A0D2F339   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPTKSKSSKRAPSNKTGPWSHydrophilic
NLS Segment(s)
PositionSequence
169-175GKGKGRR
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028020  ASX_DEUBAD_dom  
Pfam View protein in Pfam  
PF13919  ASXH  
Amino Acid Sequences MPPTKSKSSKRAPSNKTGPWSTARILNSTSPVANKDIHAFLVQCISGWNENYTEEEKRAIIDRLPPRFHTHDVDEAGSLLCPISADFVLEDPYLKAAVPRFKQHVNEGYYEQGWQNKARKAMQERREGKFDAYLQEEIEAAFGDGEDVGDNDPNVQEGGLSSDGEWRAGKGKGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.77
4 0.71
5 0.63
6 0.57
7 0.55
8 0.46
9 0.43
10 0.37
11 0.32
12 0.32
13 0.31
14 0.29
15 0.26
16 0.26
17 0.21
18 0.22
19 0.22
20 0.21
21 0.2
22 0.2
23 0.19
24 0.18
25 0.18
26 0.17
27 0.15
28 0.16
29 0.14
30 0.11
31 0.1
32 0.12
33 0.12
34 0.13
35 0.13
36 0.12
37 0.12
38 0.15
39 0.17
40 0.17
41 0.16
42 0.16
43 0.15
44 0.15
45 0.17
46 0.15
47 0.14
48 0.21
49 0.27
50 0.32
51 0.35
52 0.36
53 0.39
54 0.42
55 0.43
56 0.38
57 0.34
58 0.32
59 0.31
60 0.3
61 0.24
62 0.2
63 0.17
64 0.13
65 0.1
66 0.06
67 0.04
68 0.03
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.06
76 0.06
77 0.07
78 0.05
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.15
85 0.17
86 0.21
87 0.24
88 0.27
89 0.3
90 0.33
91 0.37
92 0.33
93 0.33
94 0.31
95 0.29
96 0.26
97 0.25
98 0.21
99 0.17
100 0.17
101 0.2
102 0.24
103 0.26
104 0.3
105 0.32
106 0.39
107 0.45
108 0.53
109 0.56
110 0.61
111 0.64
112 0.64
113 0.65
114 0.59
115 0.5
116 0.46
117 0.4
118 0.33
119 0.3
120 0.27
121 0.23
122 0.22
123 0.2
124 0.15
125 0.13
126 0.09
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.06
137 0.06
138 0.07
139 0.07
140 0.08
141 0.08
142 0.07
143 0.06
144 0.06
145 0.1
146 0.1
147 0.11
148 0.1
149 0.16
150 0.16
151 0.18
152 0.18
153 0.15
154 0.18
155 0.22