Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2FHF4

Protein Details
Accession A0A0D2FHF4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
97-116MRWKTNKELARKVPRRTIKYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, E.R. 6, extr 4, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022703  DUF3533  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12051  DUF3533  
Amino Acid Sequences MYALGLASENVTMIIGQPGTALWLIFWVISNVSTSFYAIPLAPGFFKFGYAWPLYHIVNGSRTILFDTYSQIGLNFGVLFVWCAVNTLLFPFCCVFMRWKTNKELARKVPRRTIKYLVDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.08
7 0.08
8 0.07
9 0.05
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.08
18 0.08
19 0.09
20 0.09
21 0.1
22 0.09
23 0.09
24 0.1
25 0.08
26 0.09
27 0.08
28 0.08
29 0.08
30 0.08
31 0.1
32 0.09
33 0.1
34 0.09
35 0.1
36 0.13
37 0.13
38 0.13
39 0.13
40 0.15
41 0.14
42 0.14
43 0.14
44 0.11
45 0.12
46 0.12
47 0.12
48 0.1
49 0.1
50 0.1
51 0.1
52 0.1
53 0.08
54 0.1
55 0.1
56 0.1
57 0.1
58 0.09
59 0.09
60 0.08
61 0.08
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.04
70 0.06
71 0.06
72 0.06
73 0.06
74 0.07
75 0.09
76 0.08
77 0.1
78 0.1
79 0.11
80 0.12
81 0.13
82 0.17
83 0.22
84 0.32
85 0.37
86 0.41
87 0.46
88 0.53
89 0.58
90 0.61
91 0.64
92 0.65
93 0.7
94 0.74
95 0.75
96 0.77
97 0.81
98 0.79
99 0.77
100 0.75