Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2ELS5

Protein Details
Accession A0A0D2ELS5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-26YSSIGQKVRRKARGRLDPHQLFHydrophilic
124-147SNPERYARIRSRSKRNAPVRYTKAHydrophilic
NLS Segment(s)
PositionSequence
14-17RKAR
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MAVSYSSIGQKVRRKARGRLDPHQLFATKRRRLDTAESRQHNSELRKLITSQAAETVQKMLIQSSHLAGHFQDALGRVSLSSEVLRDEILQELMRTKEELQRELKTDFWRNVNSSTLLTTPDLSNPERYARIRSRSKRNAPVRYTKAVVRWLPDDPSPDGSNPDSNQDEHLVQLLTADRIWKAGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.77
4 0.8
5 0.81
6 0.79
7 0.8
8 0.74
9 0.71
10 0.67
11 0.59
12 0.51
13 0.52
14 0.54
15 0.49
16 0.5
17 0.5
18 0.48
19 0.5
20 0.57
21 0.58
22 0.59
23 0.62
24 0.62
25 0.63
26 0.61
27 0.59
28 0.55
29 0.48
30 0.43
31 0.39
32 0.36
33 0.34
34 0.33
35 0.34
36 0.33
37 0.3
38 0.24
39 0.22
40 0.22
41 0.2
42 0.2
43 0.18
44 0.14
45 0.14
46 0.13
47 0.1
48 0.09
49 0.1
50 0.1
51 0.1
52 0.11
53 0.1
54 0.11
55 0.1
56 0.11
57 0.1
58 0.09
59 0.09
60 0.08
61 0.09
62 0.09
63 0.09
64 0.07
65 0.07
66 0.08
67 0.07
68 0.06
69 0.05
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.08
81 0.08
82 0.08
83 0.09
84 0.13
85 0.14
86 0.18
87 0.21
88 0.22
89 0.25
90 0.25
91 0.27
92 0.28
93 0.31
94 0.29
95 0.29
96 0.3
97 0.29
98 0.29
99 0.28
100 0.25
101 0.2
102 0.19
103 0.16
104 0.15
105 0.14
106 0.13
107 0.11
108 0.12
109 0.15
110 0.15
111 0.17
112 0.17
113 0.19
114 0.22
115 0.23
116 0.29
117 0.32
118 0.4
119 0.48
120 0.55
121 0.63
122 0.7
123 0.78
124 0.8
125 0.83
126 0.84
127 0.81
128 0.83
129 0.78
130 0.73
131 0.67
132 0.59
133 0.54
134 0.52
135 0.47
136 0.4
137 0.37
138 0.34
139 0.34
140 0.33
141 0.32
142 0.27
143 0.3
144 0.29
145 0.27
146 0.28
147 0.27
148 0.3
149 0.27
150 0.3
151 0.28
152 0.27
153 0.28
154 0.28
155 0.26
156 0.21
157 0.23
158 0.17
159 0.14
160 0.15
161 0.14
162 0.12
163 0.12
164 0.14
165 0.11