Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2D2N9

Protein Details
Accession A0A0D2D2N9   
Localization Confidence High
Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
22-46GPSTSKSKSAKRPSSKQVKTRPGSHHydrophilic
NLS Segment(s)
PositionSequence
8-43ASKNNPKARKSATAGPSTSKSKSAKRPSSKQVKTRP
132-182ARRAEMEKKKEHKQQALEEVKKGLKKGKKGSDKELQAERDVPKEKKSKKRV
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences MAPKPPSASKNNPKARKSATAGPSTSKSKSAKRPSSKQVKTRPGSHSNTGSSNAKTSKKHARTYTDKELGLPTLNMITPVGVQKPSGKKKGKIFVDDKESMMTILAMVNAEKEGQIESKMMKARQMEEIREARRAEMEKKKEHKQQALEEVKKGLKKGKKGSDKELQAERDVPKEKKSKKRVSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.72
4 0.68
5 0.67
6 0.63
7 0.61
8 0.6
9 0.57
10 0.55
11 0.51
12 0.47
13 0.44
14 0.42
15 0.43
16 0.52
17 0.58
18 0.64
19 0.69
20 0.76
21 0.8
22 0.86
23 0.86
24 0.85
25 0.85
26 0.84
27 0.8
28 0.79
29 0.77
30 0.74
31 0.72
32 0.68
33 0.62
34 0.55
35 0.51
36 0.48
37 0.43
38 0.35
39 0.33
40 0.32
41 0.32
42 0.31
43 0.35
44 0.42
45 0.46
46 0.52
47 0.54
48 0.57
49 0.61
50 0.68
51 0.72
52 0.66
53 0.59
54 0.53
55 0.48
56 0.4
57 0.32
58 0.23
59 0.14
60 0.09
61 0.09
62 0.08
63 0.07
64 0.06
65 0.06
66 0.07
67 0.08
68 0.07
69 0.08
70 0.13
71 0.22
72 0.28
73 0.36
74 0.4
75 0.44
76 0.51
77 0.59
78 0.58
79 0.56
80 0.54
81 0.49
82 0.52
83 0.47
84 0.41
85 0.33
86 0.29
87 0.22
88 0.18
89 0.13
90 0.06
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.06
103 0.07
104 0.07
105 0.12
106 0.16
107 0.16
108 0.18
109 0.2
110 0.21
111 0.29
112 0.32
113 0.3
114 0.33
115 0.39
116 0.38
117 0.41
118 0.39
119 0.31
120 0.32
121 0.33
122 0.35
123 0.38
124 0.43
125 0.48
126 0.54
127 0.63
128 0.67
129 0.72
130 0.72
131 0.69
132 0.7
133 0.71
134 0.75
135 0.69
136 0.62
137 0.58
138 0.54
139 0.49
140 0.44
141 0.42
142 0.38
143 0.44
144 0.52
145 0.58
146 0.64
147 0.68
148 0.74
149 0.75
150 0.75
151 0.73
152 0.71
153 0.64
154 0.56
155 0.56
156 0.5
157 0.48
158 0.49
159 0.45
160 0.46
161 0.53
162 0.6
163 0.65
164 0.74
165 0.77