Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3HPF1

Protein Details
Accession A0A0C3HPF1    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
138-164MEGKKKMEKEKGKGVKKGKKIKLSFGDBasic
NLS Segment(s)
PositionSequence
106-117GMRKKRKVGRVI
139-159EGKKKMEKEKGKGVKKGKKIK
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSKITSKNLHYDTTLPPFLARLQASHSARDDRHEFDVARPRKKRDADEEREDEPVYVDGDTGEVVSLEEKMREGGKKEEKDEGEGKEEGSAEGERRMRENMAVIGGMRKKRKVGRVIGGDDGGRGEGERIEKEDSDGMEGKKKMEKEKGKGVKKGKKIKLSFGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.31
3 0.28
4 0.27
5 0.26
6 0.28
7 0.22
8 0.16
9 0.2
10 0.29
11 0.3
12 0.33
13 0.35
14 0.34
15 0.34
16 0.39
17 0.38
18 0.32
19 0.34
20 0.34
21 0.32
22 0.32
23 0.42
24 0.44
25 0.5
26 0.52
27 0.54
28 0.59
29 0.63
30 0.64
31 0.64
32 0.68
33 0.66
34 0.7
35 0.69
36 0.62
37 0.58
38 0.52
39 0.41
40 0.31
41 0.23
42 0.15
43 0.1
44 0.08
45 0.06
46 0.06
47 0.06
48 0.05
49 0.04
50 0.03
51 0.03
52 0.03
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.08
59 0.09
60 0.11
61 0.18
62 0.26
63 0.29
64 0.3
65 0.35
66 0.34
67 0.37
68 0.37
69 0.31
70 0.26
71 0.24
72 0.22
73 0.17
74 0.17
75 0.13
76 0.11
77 0.1
78 0.07
79 0.11
80 0.13
81 0.13
82 0.14
83 0.15
84 0.14
85 0.14
86 0.15
87 0.12
88 0.11
89 0.1
90 0.09
91 0.12
92 0.16
93 0.2
94 0.22
95 0.23
96 0.28
97 0.33
98 0.41
99 0.45
100 0.48
101 0.52
102 0.57
103 0.58
104 0.55
105 0.5
106 0.42
107 0.34
108 0.27
109 0.18
110 0.11
111 0.07
112 0.06
113 0.07
114 0.09
115 0.1
116 0.12
117 0.15
118 0.15
119 0.17
120 0.19
121 0.17
122 0.19
123 0.22
124 0.21
125 0.26
126 0.27
127 0.27
128 0.3
129 0.33
130 0.37
131 0.43
132 0.51
133 0.51
134 0.62
135 0.69
136 0.73
137 0.78
138 0.81
139 0.8
140 0.81
141 0.85
142 0.83
143 0.83
144 0.79
145 0.81
146 0.8