FuNGI

Q4WC65

Protein Details

Accession

Q4WC65

Localization Confidence

Medium

Confidence Score

14.7

NoLS Segment(s)

Position	Sequence	Protein Nature
89-108	EEKINKIKWCRRQNASHFLL	Hydrophilic

NLS Segment(s)

Position	Sequence
410-427	NKNGKKNGSRAGSPAGPG

Subcellular Location(s)

nucl 18, cyto 5, mito 1, pero 1, golg 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR000009 PP2A_PR55 IPR018067 PP2A_PR55_CS IPR015943 WD40/YVTN_repeat-like_dom_sf IPR001680 WD40_repeat IPR036322 WD40_repeat_dom_sf
Gene Ontology	GO:0005935 C:cellular bud neck GO:0005934 C:cellular bud tip GO:0005829 C:cytosol GO:0000329 C:fungal-type vacuole membrane GO:0043332 C:mating projection tip GO:0072686 C:mitotic spindle GO:0005634 C:nucleus GO:0000159 C:protein phosphatase type 2A complex GO:0016787 F:hydrolase activity GO:0019888 F:protein phosphatase regulator activity GO:0045143 P:homologous chromosome segregation GO:0016237 P:lysosomal microautophagy GO:0044818 P:mitotic G2/M transition checkpoint GO:0001100 P:negative regulation of exit from mitosis GO:0010515 P:negative regulation of induction of conjugation with cellular fusion GO:0031030 P:negative regulation of septation initiation signaling GO:2000786 P:positive regulation of autophagosome assembly GO:0010971 P:positive regulation of G2/M transition of mitotic cell cycle GO:1905477 P:positive regulation of protein localization to membrane GO:1900182 P:positive regulation of protein localization to nucleus GO:0061586 P:positive regulation of transcription by transcription factor localization GO:0006470 P:protein dephosphorylation GO:0090266 P:regulation of mitotic cell cycle spindle assembly checkpoint
KEGG	afm:AFUA_8G05560 -
Pfam	View protein in Pfam PF00400 WD40
PROSITE	View protein in PROSITE PS01024 PR55_1 PS01025 PR55_2

Amino Acid Sequences

MVDREPGTPTWKFTQCFGDKGDVEDITEADIISTVEFDHTGNYLATGDKGGRVVLFERNETKKTCEYKFHTEFQSHEPEFDYLKSLEIEEKINKIKWCRRQNASHFLLSTNDKTIKLWKVFDKSLKVVAENNLSNELTPAGAVGGGGAPRAPRLSFKDASALKLPRMTHHDTVVAAVPRRTYANAHAYHINSISVNSDGETFISSDDLRINLWNLNIQDQSFNIVDIKPANMEELTEVITAAEFHPISCNWFMYASSKGTIKLADMRQRALCDEHSKLFEQEEDASSRSFFSEIISSISDVRFSHDGRYIVSRDYLTVKIWDVNMERQPVKTIPIHEHLRPRLCDTYENDSIFDKFEVVFSGDAENVMTGSYNNNFMIYPTDPSKETEIVLQADKSAFKAKKVGVPTPMNKNGKKNGSRAGSPAGPGSRMKKETDADQIDFNKKILHMSWHPYEDSIAIAATNNVSILALHFPSCYHSCDFAKVLIQSEQLFVFSAL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.46
3	0.47
4	0.46
5	0.46
6	0.4
7	0.42
8	0.43
9	0.33
10	0.3
11	0.27
12	0.24
13	0.17
14	0.17
15	0.13
16	0.09
17	0.09
18	0.08
19	0.07
20	0.07
21	0.06
22	0.06
23	0.07
24	0.07
25	0.08
26	0.08
27	0.1
28	0.1
29	0.1
30	0.1
31	0.1
32	0.11
33	0.11
34	0.11
35	0.11
36	0.12
37	0.11
38	0.11
39	0.12
40	0.14
41	0.19
42	0.21
43	0.24
44	0.31
45	0.35
46	0.39
47	0.4
48	0.43
49	0.45
50	0.49
51	0.5
52	0.52
53	0.54
54	0.61
55	0.64
56	0.65
57	0.62
58	0.58
59	0.56
60	0.52
61	0.55
62	0.45
63	0.4
64	0.36
65	0.32
66	0.31
67	0.28
68	0.26
69	0.16
70	0.17
71	0.17
72	0.15
73	0.17
74	0.17
75	0.2
76	0.19
77	0.24
78	0.27
79	0.32
80	0.34
81	0.4
82	0.47
83	0.53
84	0.61
85	0.65
86	0.68
87	0.74
88	0.79
89	0.81
90	0.77
91	0.7
92	0.61
93	0.53
94	0.49
95	0.42
96	0.35
97	0.3
98	0.28
99	0.24
100	0.24
101	0.3
102	0.34
103	0.34
104	0.37
105	0.38
106	0.41
107	0.46
108	0.51
109	0.5
110	0.45
111	0.48
112	0.44
113	0.39
114	0.36
115	0.34
116	0.34
117	0.29
118	0.29
119	0.26
120	0.24
121	0.23
122	0.2
123	0.17
124	0.1
125	0.09
126	0.07
127	0.04
128	0.04
129	0.04
130	0.04
131	0.04
132	0.04
133	0.04
134	0.05
135	0.05
136	0.06
137	0.07
138	0.07
139	0.1
140	0.17
141	0.24
142	0.25
143	0.26
144	0.33
145	0.33
146	0.36
147	0.39
148	0.34
149	0.28
150	0.31
151	0.31
152	0.26
153	0.32
154	0.35
155	0.3
156	0.3
157	0.3
158	0.26
159	0.27
160	0.27
161	0.23
162	0.19
163	0.17
164	0.16
165	0.15
166	0.16
167	0.16
168	0.14
169	0.17
170	0.24
171	0.25
172	0.27
173	0.3
174	0.29
175	0.3
176	0.28
177	0.23
178	0.15
179	0.13
180	0.12
181	0.09
182	0.08
183	0.07
184	0.07
185	0.07
186	0.07
187	0.07
188	0.06
189	0.06
190	0.07
191	0.06
192	0.06
193	0.07
194	0.07
195	0.07
196	0.07
197	0.08
198	0.09
199	0.09
200	0.11
201	0.11
202	0.13
203	0.13
204	0.13
205	0.12
206	0.11
207	0.14
208	0.11
209	0.11
210	0.09
211	0.09
212	0.09
213	0.09
214	0.1
215	0.07
216	0.07
217	0.07
218	0.06
219	0.06
220	0.06
221	0.06
222	0.07
223	0.06
224	0.06
225	0.05
226	0.05
227	0.05
228	0.05
229	0.07
230	0.06
231	0.06
232	0.07
233	0.07
234	0.1
235	0.1
236	0.1
237	0.08
238	0.09
239	0.09
240	0.1
241	0.12
242	0.11
243	0.11
244	0.12
245	0.12
246	0.12
247	0.12
248	0.1
249	0.15
250	0.18
251	0.24
252	0.25
253	0.27
254	0.27
255	0.28
256	0.28
257	0.24
258	0.22
259	0.19
260	0.2
261	0.2
262	0.21
263	0.21
264	0.21
265	0.19
266	0.17
267	0.14
268	0.13
269	0.13
270	0.12
271	0.12
272	0.12
273	0.12
274	0.12
275	0.1
276	0.09
277	0.07
278	0.07
279	0.07
280	0.08
281	0.1
282	0.1
283	0.1
284	0.11
285	0.11
286	0.11
287	0.1
288	0.12
289	0.13
290	0.13
291	0.15
292	0.19
293	0.19
294	0.19
295	0.23
296	0.21
297	0.2
298	0.21
299	0.18
300	0.15
301	0.18
302	0.17
303	0.14
304	0.15
305	0.14
306	0.15
307	0.15
308	0.17
309	0.16
310	0.2
311	0.22
312	0.26
313	0.26
314	0.24
315	0.27
316	0.24
317	0.26
318	0.24
319	0.23
320	0.24
321	0.3
322	0.34
323	0.35
324	0.43
325	0.45
326	0.48
327	0.47
328	0.47
329	0.44
330	0.42
331	0.42
332	0.39
333	0.41
334	0.41
335	0.4
336	0.36
337	0.32
338	0.31
339	0.27
340	0.22
341	0.15
342	0.09
343	0.09
344	0.09
345	0.1
346	0.09
347	0.09
348	0.1
349	0.09
350	0.09
351	0.08
352	0.07
353	0.06
354	0.06
355	0.05
356	0.04
357	0.06
358	0.07
359	0.1
360	0.1
361	0.1
362	0.1
363	0.11
364	0.15
365	0.14
366	0.17
367	0.17
368	0.19
369	0.19
370	0.22
371	0.25
372	0.22
373	0.21
374	0.2
375	0.21
376	0.21
377	0.22
378	0.19
379	0.17
380	0.17
381	0.17
382	0.16
383	0.22
384	0.21
385	0.21
386	0.27
387	0.29
388	0.33
389	0.39
390	0.42
391	0.42
392	0.49
393	0.53
394	0.57
395	0.64
396	0.65
397	0.64
398	0.66
399	0.67
400	0.68
401	0.68
402	0.64
403	0.63
404	0.61
405	0.59
406	0.55
407	0.52
408	0.44
409	0.39
410	0.39
411	0.31
412	0.28
413	0.3
414	0.32
415	0.34
416	0.35
417	0.36
418	0.37
419	0.38
420	0.41
421	0.48
422	0.48
423	0.41
424	0.45
425	0.48
426	0.47
427	0.45
428	0.41
429	0.33
430	0.28
431	0.29
432	0.25
433	0.27
434	0.28
435	0.35
436	0.41
437	0.41
438	0.41
439	0.39
440	0.38
441	0.3
442	0.25
443	0.18
444	0.12
445	0.09
446	0.09
447	0.09
448	0.08
449	0.08
450	0.07
451	0.06
452	0.06
453	0.06
454	0.07
455	0.1
456	0.11
457	0.11
458	0.12
459	0.12
460	0.18
461	0.2
462	0.22
463	0.22
464	0.27
465	0.28
466	0.33
467	0.34
468	0.31
469	0.34
470	0.32
471	0.32
472	0.29
473	0.3
474	0.27
475	0.27
476	0.25
477	0.2

Q4WC65

3D AlphaFold-predicted Structure Viewer