Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3H9T4

Protein Details
Accession A0A0C3H9T4    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VAAKKHVPIVKKRTKRFHRHQSDTYKCVPSSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-17KKRTKR
Subcellular Location(s) mito 20.5, mito_nucl 12.666, cyto_nucl 4.333, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKRTKRFHRHQSDTYKCVPSSWRKPKGIDNRVRRRFKGQMVMPSIGFGSNKKTRHMMPSGHKAFLVNNTRDVDLLLMHNKTFAAEIAHAVSSRKRVEIIARAKELGVKVTNPKAKVTVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.89
4 0.9
5 0.91
6 0.91
7 0.9
8 0.9
9 0.9
10 0.87
11 0.81
12 0.76
13 0.7
14 0.59
15 0.52
16 0.5
17 0.48
18 0.51
19 0.57
20 0.6
21 0.59
22 0.62
23 0.7
24 0.74
25 0.74
26 0.73
27 0.73
28 0.75
29 0.81
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.38
42 0.32
43 0.24
44 0.19
45 0.12
46 0.13
47 0.18
48 0.19
49 0.21
50 0.23
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.35
61 0.31
62 0.33
63 0.34
64 0.24
65 0.25
66 0.26
67 0.26
68 0.26
69 0.25
70 0.18
71 0.11
72 0.13
73 0.12
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.09
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.12
88 0.13
89 0.17
90 0.17
91 0.17
92 0.17
93 0.18
94 0.24
95 0.32
96 0.39
97 0.41
98 0.42
99 0.42
100 0.41
101 0.43
102 0.38
103 0.33
104 0.27
105 0.23
106 0.27
107 0.36
108 0.41
109 0.39
110 0.41
111 0.4