Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3HN97

Protein Details
Accession A0A0C3HN97    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41FADMRPSKAHPEHRARRKQLERDSPAFHydrophilic
NLS Segment(s)
PositionSequence
72-136ERRREEEGERERTGRRKGDDDDGESRGRSEGGRERRRIDGEERRERREQRHAGGRERTKDRGVKV
Subcellular Location(s) mito 9, nucl 7, E.R. 3, cyto 2, plas 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MVLDKLQRKVFSPPFADMRPSKAHPEHRARRKQLERDSPAFDMKDFGIKTAMIGLLALVACFPWEKELEKHERRREEEGERERTGRRKGDDDDGESRGRSEGGRERRRIDGEERRERREQRHAGGRERTKDRGVKVYRHGKSYAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.52
4 0.43
5 0.42
6 0.41
7 0.4
8 0.43
9 0.45
10 0.52
11 0.55
12 0.65
13 0.69
14 0.74
15 0.81
16 0.81
17 0.84
18 0.85
19 0.85
20 0.84
21 0.84
22 0.81
23 0.75
24 0.72
25 0.64
26 0.58
27 0.49
28 0.38
29 0.29
30 0.22
31 0.23
32 0.18
33 0.16
34 0.14
35 0.13
36 0.13
37 0.13
38 0.13
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.05
52 0.08
53 0.1
54 0.15
55 0.25
56 0.33
57 0.41
58 0.46
59 0.51
60 0.53
61 0.56
62 0.55
63 0.51
64 0.53
65 0.52
66 0.52
67 0.47
68 0.46
69 0.43
70 0.45
71 0.44
72 0.4
73 0.35
74 0.33
75 0.35
76 0.41
77 0.41
78 0.41
79 0.39
80 0.38
81 0.36
82 0.31
83 0.29
84 0.21
85 0.18
86 0.13
87 0.14
88 0.2
89 0.3
90 0.38
91 0.42
92 0.44
93 0.49
94 0.52
95 0.51
96 0.52
97 0.51
98 0.53
99 0.61
100 0.62
101 0.63
102 0.68
103 0.69
104 0.68
105 0.68
106 0.65
107 0.63
108 0.68
109 0.68
110 0.69
111 0.74
112 0.74
113 0.72
114 0.7
115 0.66
116 0.64
117 0.63
118 0.59
119 0.6
120 0.58
121 0.57
122 0.61
123 0.68
124 0.64
125 0.63