Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3HLT5

Protein Details
Accession A0A0C3HLT5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-68RASQRAFRRRKEKHTKEVEEKBasic
NLS Segment(s)
PositionSequence
43-61RRAQNRASQRAFRRRKEKH
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences IGMIPVESILAEPGIESYFETPSSQRRENGNENAVSPYVIARRRAQNRASQRAFRRRKEKHTKEVEEKLADLQGRHSELIHLYEALQLEYSAVIKEIQVLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.09
6 0.1
7 0.11
8 0.12
9 0.18
10 0.25
11 0.28
12 0.3
13 0.34
14 0.4
15 0.46
16 0.51
17 0.49
18 0.43
19 0.41
20 0.38
21 0.34
22 0.26
23 0.19
24 0.14
25 0.14
26 0.16
27 0.18
28 0.2
29 0.28
30 0.34
31 0.4
32 0.41
33 0.45
34 0.51
35 0.58
36 0.58
37 0.56
38 0.58
39 0.63
40 0.69
41 0.68
42 0.69
43 0.67
44 0.74
45 0.79
46 0.8
47 0.79
48 0.81
49 0.82
50 0.79
51 0.8
52 0.74
53 0.63
54 0.55
55 0.46
56 0.38
57 0.31
58 0.23
59 0.19
60 0.17
61 0.18
62 0.17
63 0.17
64 0.15
65 0.16
66 0.18
67 0.16
68 0.13
69 0.11
70 0.13
71 0.14
72 0.13
73 0.12
74 0.09
75 0.08
76 0.09
77 0.09
78 0.07
79 0.07
80 0.07
81 0.07