Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WWK2

Protein Details
Accession Q4WWK2   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
192-219DYHYTPRKPSERKRRTSSRQFSKNTKPAHydrophilic
NLS Segment(s)
PositionSequence
199-206KPSERKRR
Subcellular Location(s) nucl 14, cyto_nucl 13.5, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0009653  P:anatomical structure morphogenesis  
GO:0030154  P:cell differentiation  
GO:0007618  P:mating  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0043940  P:regulation of sexual sporulation resulting in formation of a cellular spore  
GO:0043935  P:sexual sporulation resulting in formation of a cellular spore  
KEGG afm:AFUA_3G06170  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MATVPIAMKPAAESTDTLTELLWQDALRHLESTNNEVLLPINVTDMIGQDNVDKIKTRLGALIGAPVVAFVDETIKALRVMRTPAFSGTAVSVASHGEAVKTNKVTVTESFAPRGKPVGPLKAPKVPRPPNAFILYRQHHHPKIKEAYPDYSNNDISVMLGKQWKDENEEIKTQFRNLAEELKKKHAEDHPDYHYTPRKPSERKRRTSSRQFSKNTKPAALRDTPASMNISSDVSTPAMLEGMPVGEIDFNAAFEDVPGINAIMTSNSILKNQQYHFEPNAFDLMNQVQNDYNKTALYQQLSLPEGQIGENFEFTDFISDCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.22
4 0.2
5 0.18
6 0.19
7 0.19
8 0.19
9 0.16
10 0.11
11 0.12
12 0.17
13 0.2
14 0.18
15 0.18
16 0.17
17 0.22
18 0.24
19 0.28
20 0.25
21 0.23
22 0.21
23 0.21
24 0.21
25 0.17
26 0.16
27 0.11
28 0.09
29 0.08
30 0.09
31 0.09
32 0.08
33 0.09
34 0.08
35 0.08
36 0.08
37 0.11
38 0.12
39 0.13
40 0.14
41 0.13
42 0.18
43 0.2
44 0.2
45 0.2
46 0.2
47 0.21
48 0.2
49 0.22
50 0.17
51 0.15
52 0.14
53 0.11
54 0.1
55 0.07
56 0.06
57 0.03
58 0.05
59 0.05
60 0.07
61 0.07
62 0.08
63 0.09
64 0.11
65 0.14
66 0.14
67 0.19
68 0.2
69 0.22
70 0.23
71 0.23
72 0.24
73 0.21
74 0.2
75 0.15
76 0.14
77 0.11
78 0.1
79 0.09
80 0.07
81 0.07
82 0.07
83 0.06
84 0.06
85 0.09
86 0.12
87 0.16
88 0.16
89 0.17
90 0.17
91 0.18
92 0.2
93 0.17
94 0.22
95 0.23
96 0.24
97 0.27
98 0.28
99 0.27
100 0.26
101 0.27
102 0.21
103 0.23
104 0.25
105 0.3
106 0.32
107 0.36
108 0.4
109 0.45
110 0.47
111 0.46
112 0.53
113 0.52
114 0.56
115 0.59
116 0.59
117 0.57
118 0.58
119 0.53
120 0.46
121 0.47
122 0.42
123 0.36
124 0.37
125 0.39
126 0.41
127 0.45
128 0.44
129 0.44
130 0.47
131 0.49
132 0.5
133 0.45
134 0.43
135 0.41
136 0.42
137 0.37
138 0.34
139 0.3
140 0.24
141 0.22
142 0.17
143 0.14
144 0.12
145 0.09
146 0.07
147 0.09
148 0.09
149 0.11
150 0.12
151 0.13
152 0.17
153 0.19
154 0.22
155 0.23
156 0.27
157 0.27
158 0.29
159 0.28
160 0.24
161 0.25
162 0.21
163 0.2
164 0.17
165 0.24
166 0.25
167 0.31
168 0.33
169 0.37
170 0.39
171 0.37
172 0.42
173 0.37
174 0.41
175 0.42
176 0.44
177 0.42
178 0.44
179 0.44
180 0.44
181 0.47
182 0.4
183 0.39
184 0.41
185 0.44
186 0.49
187 0.59
188 0.65
189 0.68
190 0.75
191 0.79
192 0.83
193 0.84
194 0.87
195 0.87
196 0.86
197 0.86
198 0.83
199 0.82
200 0.82
201 0.79
202 0.71
203 0.65
204 0.58
205 0.52
206 0.52
207 0.47
208 0.38
209 0.33
210 0.33
211 0.28
212 0.27
213 0.25
214 0.19
215 0.16
216 0.15
217 0.14
218 0.11
219 0.11
220 0.11
221 0.09
222 0.09
223 0.09
224 0.08
225 0.07
226 0.06
227 0.06
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.06
236 0.06
237 0.06
238 0.06
239 0.07
240 0.06
241 0.06
242 0.08
243 0.06
244 0.07
245 0.07
246 0.06
247 0.06
248 0.06
249 0.07
250 0.05
251 0.06
252 0.07
253 0.09
254 0.1
255 0.12
256 0.14
257 0.17
258 0.23
259 0.24
260 0.29
261 0.3
262 0.36
263 0.38
264 0.39
265 0.37
266 0.32
267 0.35
268 0.29
269 0.24
270 0.21
271 0.21
272 0.23
273 0.22
274 0.22
275 0.21
276 0.24
277 0.28
278 0.27
279 0.24
280 0.19
281 0.21
282 0.24
283 0.25
284 0.26
285 0.24
286 0.24
287 0.28
288 0.3
289 0.29
290 0.25
291 0.21
292 0.18
293 0.17
294 0.17
295 0.15
296 0.15
297 0.15
298 0.15
299 0.14
300 0.14
301 0.14
302 0.17