Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3D318

Protein Details
Accession A0A0C3D318    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
120-147DHDHGHDKRKVKRKRSPNAYEKAPKPKSBasic
NLS Segment(s)
PositionSequence
113-115RGR
123-151HGHDKRKVKRKRSPNAYEKAPKPKSGGSK
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MSAGQRNVAQSGQTRLHSSAPSTTTTTIRPQAVLHLRGAPRGDEQGDREESEGRRIQWAEDVIDNEGMGKKKSKVCCIYHAPKGIDESSDESSSDSDSDSDSGDDGAARPSRRGRSHDHDHDHGHDKRKVKRKRSPNAYEKAPKPKSGGSKEVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.33
4 0.31
5 0.3
6 0.29
7 0.27
8 0.27
9 0.27
10 0.27
11 0.26
12 0.27
13 0.3
14 0.3
15 0.29
16 0.27
17 0.24
18 0.3
19 0.35
20 0.35
21 0.31
22 0.32
23 0.32
24 0.34
25 0.34
26 0.27
27 0.22
28 0.22
29 0.22
30 0.18
31 0.2
32 0.22
33 0.23
34 0.22
35 0.21
36 0.23
37 0.22
38 0.26
39 0.26
40 0.21
41 0.24
42 0.23
43 0.23
44 0.22
45 0.22
46 0.18
47 0.17
48 0.17
49 0.14
50 0.14
51 0.13
52 0.1
53 0.11
54 0.1
55 0.1
56 0.11
57 0.14
58 0.19
59 0.23
60 0.3
61 0.35
62 0.37
63 0.42
64 0.49
65 0.51
66 0.51
67 0.53
68 0.46
69 0.4
70 0.39
71 0.33
72 0.25
73 0.2
74 0.19
75 0.15
76 0.15
77 0.14
78 0.12
79 0.12
80 0.12
81 0.11
82 0.08
83 0.06
84 0.06
85 0.06
86 0.07
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.05
93 0.09
94 0.12
95 0.12
96 0.15
97 0.2
98 0.28
99 0.32
100 0.36
101 0.41
102 0.47
103 0.56
104 0.64
105 0.65
106 0.62
107 0.61
108 0.62
109 0.62
110 0.59
111 0.57
112 0.52
113 0.53
114 0.57
115 0.64
116 0.69
117 0.71
118 0.75
119 0.78
120 0.84
121 0.88
122 0.9
123 0.89
124 0.88
125 0.87
126 0.87
127 0.84
128 0.84
129 0.77
130 0.7
131 0.65
132 0.64
133 0.64
134 0.62