Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3D4H8

Protein Details
Accession A0A0C3D4H8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-35GVAPGDPLPHKKKRRYRPGTVALKEIHydrophilic
NLS Segment(s)
PositionSequence
17-27LPHKKKRRYRP
Subcellular Location(s) mito 13.5, nucl 10, cyto_mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000164  Histone_H3/CENP-A  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00959  HISTONE_H3_2  
Amino Acid Sequences MPPKGARASGVAPGDPLPHKKKRRYRPGTVALKEIRKYQSSTDLLLLRLPFSRLVREIALAMRPMGEGFRWQSQAIQALQEAAEAFLVHLFEDTNLCAIHAKRVTIMQKDIQLARRIRGQWGGLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.3
4 0.31
5 0.39
6 0.48
7 0.57
8 0.67
9 0.74
10 0.82
11 0.84
12 0.86
13 0.87
14 0.88
15 0.89
16 0.81
17 0.77
18 0.71
19 0.68
20 0.59
21 0.54
22 0.47
23 0.39
24 0.39
25 0.33
26 0.37
27 0.33
28 0.33
29 0.31
30 0.28
31 0.26
32 0.26
33 0.24
34 0.16
35 0.15
36 0.14
37 0.13
38 0.12
39 0.14
40 0.13
41 0.15
42 0.14
43 0.14
44 0.14
45 0.12
46 0.12
47 0.11
48 0.09
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.06
55 0.08
56 0.1
57 0.12
58 0.12
59 0.13
60 0.14
61 0.17
62 0.16
63 0.14
64 0.12
65 0.11
66 0.11
67 0.1
68 0.09
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.05
75 0.04
76 0.04
77 0.04
78 0.05
79 0.06
80 0.06
81 0.07
82 0.06
83 0.07
84 0.1
85 0.1
86 0.17
87 0.18
88 0.19
89 0.19
90 0.25
91 0.31
92 0.32
93 0.36
94 0.33
95 0.36
96 0.4
97 0.43
98 0.43
99 0.45
100 0.43
101 0.42
102 0.45
103 0.42
104 0.42
105 0.43