Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3HGI9

Protein Details
Accession A0A0C3HGI9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-26RKIPWRLSKFQKARQRKRLRAVDNVVHydrophilic
60-94DKYTIFDRKEKKYRKSIRKLPKWTRVSQRVNPPGYHydrophilic
NLS Segment(s)
PositionSequence
14-17RQRK
67-81RKEKKYRKSIRKLPK
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences RKIPWRLSKFQKARQRKRLRAVDNVVSVVEQALAKQGLTTKTLERWKDEMPKEEEMLPKDKYTIFDRKEKKYRKSIRKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.89
4 0.9
5 0.91
6 0.86
7 0.84
8 0.8
9 0.75
10 0.66
11 0.57
12 0.47
13 0.36
14 0.31
15 0.21
16 0.15
17 0.08
18 0.05
19 0.07
20 0.07
21 0.06
22 0.07
23 0.1
24 0.1
25 0.12
26 0.13
27 0.12
28 0.18
29 0.24
30 0.25
31 0.26
32 0.28
33 0.3
34 0.37
35 0.38
36 0.38
37 0.37
38 0.38
39 0.35
40 0.35
41 0.34
42 0.28
43 0.3
44 0.25
45 0.21
46 0.21
47 0.21
48 0.21
49 0.23
50 0.3
51 0.3
52 0.38
53 0.44
54 0.52
55 0.61
56 0.68
57 0.7
58 0.72
59 0.79
60 0.81
61 0.86
62 0.87
63 0.88
64 0.9
65 0.93
66 0.92
67 0.92
68 0.88
69 0.86
70 0.86
71 0.85
72 0.84
73 0.81
74 0.82