Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3D410

Protein Details
Accession A0A0C3D410    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
577-599PPPPVPPKTKGKRSRASPPKPLSHydrophilic
NLS Segment(s)
PositionSequence
582-596PPKTKGKRSRASPPK
Subcellular Location(s) cyto 16.5, cyto_nucl 13, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006164  Ku70/Ku80_beta-barrel_dom  
IPR024193  Ku80  
IPR036494  Ku_C_sf  
IPR005161  Ku_N  
IPR014893  Ku_PK_bind  
IPR016194  SPOC-like_C_dom_sf  
IPR002035  VWF_A  
IPR036465  vWFA_dom_sf  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0043564  C:Ku70:Ku80 complex  
GO:0005524  F:ATP binding  
GO:0003684  F:damaged DNA binding  
GO:0004386  F:helicase activity  
GO:0016787  F:hydrolase activity  
GO:0042162  F:telomeric DNA binding  
GO:0006310  P:DNA recombination  
GO:0006303  P:double-strand break repair via nonhomologous end joining  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF02735  Ku  
PF03731  Ku_N  
PF08785  Ku_PK_bind  
PROSITE View protein in PROSITE  
PS50234  VWFA  
CDD cd00873  KU80  
Amino Acid Sequences MASKEATVYIVDQGSSTGECHNGRVENDLDFGMRYIWDKIAETMIANRTTAGVGVIGFRTDATENELAESDPDAYSNISVMKPLGPMEMSHLKDLQHRIQPSDTDTGDAVSAIVVGIQLIEKFTTLKTGKPGKFARKIILLTDGQGVLEDDDIDPIAARINELDIELVIVGIDFDDAEYGFIEKDKSSVKERNEKILKALADKCSKGIFGTVEEAIADLSIPRVKTFRPYSTFKGQLSLGDAIRYPETAFRIDVDRYFRVKAAKPVSASSFVVQQPGSQQATRDAAEMPEDLSAVKNARAYKINDPSAPGGKKDVDREELAKGYEYGRTAIPISEAEENVTKLETFSSFEIVGFIPNDKYEKFLNLGESGITIAQRTNPKAVMALSSFIHALHELDSYAVARIVVKDGKDPQLLLLAPSIEPDLEALIDIPLPFAEDVRVYRFPPLDRVITTSGATLTKHRYLPSDELEDAMSNFVNNMDISKFGRDDDDNPTEYMPIEDTYSPVVHRISQAIRRRGVQPNEAVTPPAEVLIKYSVPPPELISQSGPALQNLIDAADVKKGTPHPHIPLIPYPNTNPPPPVPPKTKGKRSRASPPKPLSGLDVESLLTHPKKFKLTTVNTIPTFKQLLAAADSPSLISPAATQMGSVIHELITRSLGDQFYEQALENLSVLREQMIEFEEPGVYNEYIRDLKGRLLKGELGEGRKDLWFRIMRERRLGLIDRETAPASEVGEEEAAEFYSMRLQTGLPSRAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.11
5 0.16
6 0.16
7 0.18
8 0.23
9 0.25
10 0.25
11 0.28
12 0.28
13 0.24
14 0.25
15 0.24
16 0.2
17 0.17
18 0.17
19 0.13
20 0.12
21 0.12
22 0.13
23 0.14
24 0.16
25 0.17
26 0.18
27 0.19
28 0.19
29 0.18
30 0.21
31 0.25
32 0.24
33 0.23
34 0.21
35 0.2
36 0.19
37 0.18
38 0.13
39 0.08
40 0.07
41 0.09
42 0.1
43 0.09
44 0.09
45 0.08
46 0.1
47 0.11
48 0.11
49 0.15
50 0.17
51 0.17
52 0.18
53 0.19
54 0.17
55 0.17
56 0.17
57 0.13
58 0.1
59 0.1
60 0.09
61 0.1
62 0.1
63 0.1
64 0.11
65 0.1
66 0.11
67 0.11
68 0.12
69 0.13
70 0.13
71 0.14
72 0.12
73 0.12
74 0.19
75 0.26
76 0.26
77 0.27
78 0.28
79 0.28
80 0.33
81 0.39
82 0.4
83 0.39
84 0.39
85 0.41
86 0.42
87 0.43
88 0.41
89 0.41
90 0.34
91 0.29
92 0.26
93 0.23
94 0.2
95 0.18
96 0.13
97 0.07
98 0.07
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.04
105 0.04
106 0.05
107 0.05
108 0.06
109 0.07
110 0.07
111 0.16
112 0.16
113 0.19
114 0.27
115 0.37
116 0.39
117 0.47
118 0.55
119 0.57
120 0.65
121 0.65
122 0.62
123 0.59
124 0.58
125 0.51
126 0.49
127 0.39
128 0.32
129 0.31
130 0.25
131 0.18
132 0.17
133 0.16
134 0.1
135 0.09
136 0.08
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.05
143 0.07
144 0.07
145 0.07
146 0.06
147 0.07
148 0.08
149 0.08
150 0.08
151 0.06
152 0.06
153 0.06
154 0.05
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.02
161 0.02
162 0.03
163 0.03
164 0.04
165 0.04
166 0.05
167 0.05
168 0.06
169 0.07
170 0.07
171 0.09
172 0.13
173 0.16
174 0.22
175 0.29
176 0.35
177 0.44
178 0.47
179 0.55
180 0.57
181 0.55
182 0.51
183 0.5
184 0.45
185 0.41
186 0.43
187 0.4
188 0.39
189 0.39
190 0.37
191 0.32
192 0.31
193 0.25
194 0.23
195 0.16
196 0.13
197 0.15
198 0.14
199 0.13
200 0.12
201 0.12
202 0.09
203 0.08
204 0.06
205 0.03
206 0.05
207 0.07
208 0.07
209 0.08
210 0.09
211 0.1
212 0.18
213 0.24
214 0.3
215 0.34
216 0.4
217 0.45
218 0.53
219 0.58
220 0.5
221 0.47
222 0.4
223 0.35
224 0.33
225 0.3
226 0.22
227 0.17
228 0.17
229 0.15
230 0.15
231 0.15
232 0.11
233 0.11
234 0.12
235 0.13
236 0.13
237 0.12
238 0.15
239 0.16
240 0.18
241 0.21
242 0.23
243 0.24
244 0.24
245 0.25
246 0.27
247 0.29
248 0.34
249 0.34
250 0.34
251 0.33
252 0.34
253 0.35
254 0.34
255 0.31
256 0.24
257 0.24
258 0.21
259 0.21
260 0.19
261 0.17
262 0.15
263 0.19
264 0.21
265 0.16
266 0.16
267 0.17
268 0.2
269 0.2
270 0.19
271 0.15
272 0.13
273 0.14
274 0.13
275 0.1
276 0.08
277 0.07
278 0.07
279 0.06
280 0.07
281 0.07
282 0.08
283 0.11
284 0.11
285 0.14
286 0.18
287 0.22
288 0.28
289 0.35
290 0.37
291 0.35
292 0.36
293 0.36
294 0.38
295 0.35
296 0.28
297 0.23
298 0.23
299 0.24
300 0.26
301 0.27
302 0.23
303 0.24
304 0.25
305 0.25
306 0.23
307 0.21
308 0.18
309 0.15
310 0.13
311 0.13
312 0.12
313 0.11
314 0.1
315 0.1
316 0.1
317 0.1
318 0.1
319 0.08
320 0.1
321 0.1
322 0.1
323 0.1
324 0.11
325 0.11
326 0.1
327 0.1
328 0.08
329 0.06
330 0.07
331 0.06
332 0.07
333 0.07
334 0.09
335 0.08
336 0.08
337 0.09
338 0.09
339 0.09
340 0.08
341 0.08
342 0.07
343 0.07
344 0.08
345 0.07
346 0.09
347 0.09
348 0.1
349 0.12
350 0.12
351 0.13
352 0.13
353 0.13
354 0.11
355 0.1
356 0.09
357 0.07
358 0.06
359 0.05
360 0.04
361 0.08
362 0.11
363 0.12
364 0.14
365 0.14
366 0.14
367 0.15
368 0.15
369 0.13
370 0.1
371 0.11
372 0.09
373 0.09
374 0.09
375 0.08
376 0.08
377 0.06
378 0.06
379 0.05
380 0.06
381 0.05
382 0.05
383 0.05
384 0.05
385 0.05
386 0.05
387 0.04
388 0.04
389 0.04
390 0.07
391 0.08
392 0.08
393 0.1
394 0.13
395 0.17
396 0.17
397 0.17
398 0.15
399 0.17
400 0.16
401 0.14
402 0.12
403 0.09
404 0.09
405 0.09
406 0.09
407 0.05
408 0.05
409 0.05
410 0.04
411 0.03
412 0.04
413 0.03
414 0.03
415 0.04
416 0.04
417 0.04
418 0.03
419 0.04
420 0.04
421 0.04
422 0.05
423 0.05
424 0.06
425 0.11
426 0.13
427 0.13
428 0.16
429 0.18
430 0.18
431 0.22
432 0.24
433 0.21
434 0.2
435 0.23
436 0.23
437 0.22
438 0.22
439 0.17
440 0.16
441 0.14
442 0.14
443 0.13
444 0.16
445 0.18
446 0.2
447 0.2
448 0.22
449 0.25
450 0.29
451 0.29
452 0.29
453 0.25
454 0.24
455 0.24
456 0.21
457 0.17
458 0.14
459 0.1
460 0.06
461 0.06
462 0.05
463 0.05
464 0.05
465 0.06
466 0.05
467 0.07
468 0.08
469 0.1
470 0.1
471 0.1
472 0.13
473 0.13
474 0.15
475 0.21
476 0.24
477 0.24
478 0.24
479 0.24
480 0.21
481 0.2
482 0.18
483 0.12
484 0.08
485 0.09
486 0.08
487 0.09
488 0.1
489 0.11
490 0.11
491 0.11
492 0.11
493 0.11
494 0.12
495 0.15
496 0.18
497 0.26
498 0.34
499 0.39
500 0.41
501 0.42
502 0.47
503 0.52
504 0.52
505 0.49
506 0.45
507 0.42
508 0.43
509 0.41
510 0.35
511 0.27
512 0.23
513 0.18
514 0.15
515 0.11
516 0.08
517 0.1
518 0.11
519 0.12
520 0.11
521 0.14
522 0.15
523 0.15
524 0.16
525 0.17
526 0.19
527 0.2
528 0.21
529 0.19
530 0.19
531 0.19
532 0.22
533 0.19
534 0.15
535 0.14
536 0.12
537 0.11
538 0.1
539 0.09
540 0.06
541 0.07
542 0.07
543 0.1
544 0.1
545 0.1
546 0.13
547 0.16
548 0.2
549 0.26
550 0.31
551 0.32
552 0.38
553 0.4
554 0.4
555 0.44
556 0.46
557 0.42
558 0.39
559 0.37
560 0.4
561 0.42
562 0.39
563 0.36
564 0.32
565 0.38
566 0.42
567 0.47
568 0.45
569 0.48
570 0.57
571 0.64
572 0.73
573 0.74
574 0.77
575 0.78
576 0.78
577 0.83
578 0.84
579 0.83
580 0.83
581 0.79
582 0.76
583 0.69
584 0.63
585 0.56
586 0.49
587 0.42
588 0.32
589 0.26
590 0.19
591 0.17
592 0.17
593 0.18
594 0.16
595 0.17
596 0.19
597 0.22
598 0.28
599 0.29
600 0.35
601 0.4
602 0.45
603 0.52
604 0.57
605 0.61
606 0.57
607 0.59
608 0.53
609 0.47
610 0.42
611 0.33
612 0.27
613 0.21
614 0.2
615 0.21
616 0.22
617 0.19
618 0.17
619 0.18
620 0.15
621 0.14
622 0.12
623 0.08
624 0.07
625 0.06
626 0.08
627 0.1
628 0.1
629 0.09
630 0.09
631 0.11
632 0.12
633 0.12
634 0.1
635 0.08
636 0.1
637 0.1
638 0.1
639 0.11
640 0.1
641 0.1
642 0.13
643 0.13
644 0.14
645 0.14
646 0.15
647 0.15
648 0.16
649 0.15
650 0.13
651 0.14
652 0.13
653 0.12
654 0.11
655 0.1
656 0.09
657 0.09
658 0.09
659 0.08
660 0.08
661 0.1
662 0.11
663 0.12
664 0.12
665 0.13
666 0.13
667 0.13
668 0.14
669 0.17
670 0.14
671 0.13
672 0.13
673 0.17
674 0.17
675 0.18
676 0.19
677 0.16
678 0.22
679 0.29
680 0.31
681 0.29
682 0.32
683 0.34
684 0.32
685 0.39
686 0.38
687 0.35
688 0.34
689 0.33
690 0.31
691 0.31
692 0.31
693 0.24
694 0.28
695 0.3
696 0.32
697 0.42
698 0.5
699 0.52
700 0.59
701 0.6
702 0.55
703 0.55
704 0.57
705 0.51
706 0.48
707 0.48
708 0.42
709 0.42
710 0.4
711 0.33
712 0.3
713 0.25
714 0.2
715 0.16
716 0.14
717 0.13
718 0.12
719 0.12
720 0.11
721 0.1
722 0.1
723 0.09
724 0.09
725 0.07
726 0.13
727 0.13
728 0.13
729 0.13
730 0.13
731 0.19
732 0.27
733 0.35