Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3HBF5

Protein Details
Accession A0A0C3HBF5   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-30ASNKTAPKKKSSKPLVLEKPTKFHydrophilic
NLS Segment(s)
PositionSequence
14-20PKKKSSK
210-214KKKLK
Subcellular Location(s) mito 10, plas 9, mito_nucl 7.5, nucl 3, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences TSRTIRHASNKTAPKKKSSKPLVLEKPTKFNPPSHGSRLPRETPRYPGPQLSAEDIAMQKTNKYPSMMPPDGSFMHWFLTNKALHMYISLTTLFTLAGIVFVTNFQRNSPFADMIPPWQDLFLHPMNYSRRWLEILRLNAARTTAETDARRARKVDDVAKRAQYRKAHGLDKDDGFGGWTVKNDQELLDAVMPPTVSVSVEADAESIKEKKKLKKWLGIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.76
4 0.77
5 0.77
6 0.76
7 0.75
8 0.82
9 0.82
10 0.82
11 0.84
12 0.76
13 0.75
14 0.69
15 0.69
16 0.61
17 0.54
18 0.52
19 0.51
20 0.54
21 0.53
22 0.59
23 0.55
24 0.61
25 0.64
26 0.63
27 0.64
28 0.64
29 0.6
30 0.58
31 0.61
32 0.6
33 0.55
34 0.52
35 0.47
36 0.44
37 0.43
38 0.39
39 0.33
40 0.26
41 0.25
42 0.22
43 0.2
44 0.17
45 0.16
46 0.13
47 0.15
48 0.19
49 0.19
50 0.21
51 0.21
52 0.26
53 0.36
54 0.36
55 0.33
56 0.31
57 0.32
58 0.31
59 0.3
60 0.24
61 0.15
62 0.14
63 0.16
64 0.16
65 0.13
66 0.18
67 0.17
68 0.16
69 0.17
70 0.16
71 0.13
72 0.14
73 0.13
74 0.08
75 0.09
76 0.09
77 0.08
78 0.07
79 0.07
80 0.07
81 0.05
82 0.05
83 0.03
84 0.04
85 0.03
86 0.03
87 0.03
88 0.04
89 0.06
90 0.07
91 0.07
92 0.07
93 0.09
94 0.1
95 0.13
96 0.15
97 0.14
98 0.13
99 0.15
100 0.15
101 0.16
102 0.17
103 0.14
104 0.12
105 0.11
106 0.11
107 0.09
108 0.14
109 0.14
110 0.13
111 0.12
112 0.17
113 0.21
114 0.22
115 0.24
116 0.2
117 0.19
118 0.2
119 0.21
120 0.21
121 0.24
122 0.26
123 0.28
124 0.28
125 0.28
126 0.25
127 0.25
128 0.2
129 0.15
130 0.16
131 0.13
132 0.17
133 0.17
134 0.21
135 0.29
136 0.32
137 0.33
138 0.3
139 0.31
140 0.32
141 0.37
142 0.42
143 0.43
144 0.45
145 0.48
146 0.55
147 0.58
148 0.54
149 0.56
150 0.52
151 0.49
152 0.53
153 0.54
154 0.52
155 0.5
156 0.53
157 0.52
158 0.48
159 0.43
160 0.34
161 0.28
162 0.23
163 0.21
164 0.16
165 0.11
166 0.11
167 0.12
168 0.13
169 0.15
170 0.14
171 0.13
172 0.13
173 0.14
174 0.15
175 0.14
176 0.14
177 0.12
178 0.13
179 0.12
180 0.11
181 0.1
182 0.08
183 0.07
184 0.08
185 0.09
186 0.09
187 0.1
188 0.1
189 0.09
190 0.09
191 0.09
192 0.12
193 0.14
194 0.17
195 0.23
196 0.31
197 0.41
198 0.5
199 0.6
200 0.66