Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BWS5

Protein Details
Accession Q6BWS5   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
359-382DLTSMVKKRKPTSKNGESSKKSKKHydrophilic
NLS Segment(s)
PositionSequence
365-382KKRKPTSKNGESSKKSKK
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019544  Tetratricopeptide_SHNi-TPR_dom  
IPR011990  TPR-like_helical_dom_sf  
KEGG dha:DEHA2B08932g  -  
Pfam View protein in Pfam  
PF10516  SHNi-TPR  
Amino Acid Sequences MGYSDGINELVAEGAKLYAAKEFDDASEKYAEACENFSNEHGEEDADLLLLYGKSLFQSAVLKSEVFGGTGGNEENDDENIEKEGEQEDDGNFQFCDDAPLAEEDDDEGGAAAAEEEEEEESGNEADKQDAGGEEEEDEEEQSDFEVAWEILDLTRSLFENKLEKVQSQGEKLKSPYLSRDNEETDNEFVILTKKLSETYDLLGEVSLEAENFPQSAIDLQNCLDLRLKLYNPENSSLISESHYKLSLALEFCVEDPESRSKACEQMRLAIESVRDRNNKEKDPSKKKDNDDLVQDLEVRYQELERDPADDLKNEQMNIIKGILGEPSNGGEDKSPVANLVNDLSSVVKKKPSKPAVNDLTSMVKKRKPTSKNGESSKKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.07
5 0.1
6 0.11
7 0.12
8 0.13
9 0.14
10 0.15
11 0.2
12 0.2
13 0.2
14 0.21
15 0.2
16 0.19
17 0.2
18 0.2
19 0.15
20 0.17
21 0.16
22 0.16
23 0.18
24 0.18
25 0.2
26 0.19
27 0.19
28 0.16
29 0.15
30 0.13
31 0.13
32 0.12
33 0.08
34 0.07
35 0.06
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.07
44 0.08
45 0.12
46 0.13
47 0.16
48 0.17
49 0.17
50 0.16
51 0.2
52 0.19
53 0.15
54 0.14
55 0.11
56 0.1
57 0.11
58 0.11
59 0.07
60 0.07
61 0.08
62 0.09
63 0.09
64 0.1
65 0.09
66 0.09
67 0.1
68 0.11
69 0.1
70 0.1
71 0.11
72 0.1
73 0.1
74 0.11
75 0.1
76 0.13
77 0.13
78 0.13
79 0.12
80 0.11
81 0.11
82 0.09
83 0.12
84 0.1
85 0.09
86 0.09
87 0.11
88 0.12
89 0.11
90 0.11
91 0.08
92 0.08
93 0.07
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.03
100 0.02
101 0.03
102 0.03
103 0.03
104 0.03
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.08
119 0.07
120 0.07
121 0.07
122 0.08
123 0.08
124 0.07
125 0.07
126 0.06
127 0.06
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.05
134 0.05
135 0.04
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.04
142 0.06
143 0.06
144 0.08
145 0.08
146 0.1
147 0.14
148 0.14
149 0.19
150 0.19
151 0.19
152 0.21
153 0.26
154 0.26
155 0.27
156 0.32
157 0.29
158 0.31
159 0.32
160 0.33
161 0.29
162 0.27
163 0.29
164 0.3
165 0.31
166 0.3
167 0.32
168 0.31
169 0.32
170 0.32
171 0.27
172 0.21
173 0.19
174 0.17
175 0.13
176 0.1
177 0.1
178 0.09
179 0.07
180 0.07
181 0.07
182 0.08
183 0.09
184 0.1
185 0.1
186 0.11
187 0.11
188 0.11
189 0.1
190 0.09
191 0.09
192 0.06
193 0.06
194 0.04
195 0.03
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.03
202 0.03
203 0.05
204 0.06
205 0.06
206 0.07
207 0.07
208 0.11
209 0.11
210 0.12
211 0.13
212 0.12
213 0.14
214 0.17
215 0.17
216 0.18
217 0.22
218 0.27
219 0.27
220 0.29
221 0.27
222 0.24
223 0.25
224 0.21
225 0.18
226 0.14
227 0.15
228 0.14
229 0.15
230 0.15
231 0.14
232 0.13
233 0.13
234 0.15
235 0.13
236 0.12
237 0.11
238 0.11
239 0.11
240 0.12
241 0.12
242 0.09
243 0.11
244 0.16
245 0.17
246 0.16
247 0.18
248 0.18
249 0.25
250 0.28
251 0.31
252 0.28
253 0.33
254 0.35
255 0.36
256 0.35
257 0.29
258 0.28
259 0.26
260 0.29
261 0.29
262 0.3
263 0.32
264 0.4
265 0.46
266 0.5
267 0.53
268 0.58
269 0.62
270 0.69
271 0.74
272 0.75
273 0.77
274 0.76
275 0.78
276 0.78
277 0.71
278 0.66
279 0.62
280 0.53
281 0.45
282 0.41
283 0.31
284 0.24
285 0.2
286 0.14
287 0.11
288 0.1
289 0.12
290 0.13
291 0.16
292 0.15
293 0.16
294 0.17
295 0.22
296 0.23
297 0.22
298 0.23
299 0.26
300 0.29
301 0.27
302 0.27
303 0.25
304 0.25
305 0.25
306 0.23
307 0.16
308 0.14
309 0.14
310 0.15
311 0.12
312 0.11
313 0.1
314 0.11
315 0.12
316 0.12
317 0.12
318 0.11
319 0.12
320 0.14
321 0.14
322 0.13
323 0.12
324 0.14
325 0.14
326 0.15
327 0.15
328 0.14
329 0.12
330 0.13
331 0.14
332 0.16
333 0.18
334 0.2
335 0.26
336 0.32
337 0.4
338 0.5
339 0.59
340 0.65
341 0.69
342 0.77
343 0.78
344 0.76
345 0.7
346 0.62
347 0.6
348 0.54
349 0.53
350 0.49
351 0.44
352 0.47
353 0.54
354 0.61
355 0.6
356 0.67
357 0.72
358 0.76
359 0.82
360 0.84
361 0.86
362 0.84