Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3HFE6

Protein Details
Accession A0A0C3HFE6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
204-224AFLFIRRRRNRQVEEEYRRNAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, plas 5, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002889  WSC_carb-bd  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01822  WSC  
PROSITE View protein in PROSITE  
PS51212  WSC  
Amino Acid Sequences MKSMLAVSITLAAMLAGPCAAMNLIPESLVVARDDTTAYTYEGCFKSAGNLKLNGTNTWQSKKTCHDLCVPLGASVEATANTNECWCGNALPATADKVDDSQCNANCTGYPLEMCGSASTFSVYLTGVGTVSNSSTSSSAAPSSSSTTSASPSVVTVEGNGQTVVVTTGPTNSPTSHSSTNKAAIAAGVVVGLVVFAAAVAGGAFLFIRRRRNRQVEEEYRRNAAVSEFVAGGKTHNSDNASYSSYSDNRLDPSVMAQRRMSDGSIADNQDYSRRILKVTNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.04
9 0.06
10 0.08
11 0.08
12 0.08
13 0.08
14 0.09
15 0.1
16 0.1
17 0.1
18 0.08
19 0.09
20 0.1
21 0.1
22 0.1
23 0.11
24 0.11
25 0.12
26 0.12
27 0.12
28 0.18
29 0.18
30 0.19
31 0.17
32 0.16
33 0.22
34 0.29
35 0.33
36 0.3
37 0.33
38 0.33
39 0.39
40 0.4
41 0.35
42 0.31
43 0.33
44 0.34
45 0.36
46 0.39
47 0.35
48 0.39
49 0.44
50 0.48
51 0.46
52 0.44
53 0.46
54 0.46
55 0.46
56 0.47
57 0.41
58 0.32
59 0.29
60 0.25
61 0.18
62 0.14
63 0.12
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.08
71 0.07
72 0.08
73 0.08
74 0.08
75 0.09
76 0.1
77 0.1
78 0.1
79 0.11
80 0.11
81 0.11
82 0.11
83 0.09
84 0.1
85 0.11
86 0.11
87 0.13
88 0.17
89 0.18
90 0.2
91 0.2
92 0.18
93 0.17
94 0.19
95 0.17
96 0.12
97 0.11
98 0.1
99 0.1
100 0.1
101 0.1
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.06
108 0.06
109 0.06
110 0.06
111 0.05
112 0.05
113 0.05
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.05
123 0.06
124 0.06
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.1
131 0.09
132 0.1
133 0.11
134 0.11
135 0.12
136 0.12
137 0.11
138 0.09
139 0.08
140 0.08
141 0.08
142 0.07
143 0.06
144 0.07
145 0.07
146 0.08
147 0.07
148 0.06
149 0.06
150 0.06
151 0.06
152 0.04
153 0.04
154 0.04
155 0.05
156 0.06
157 0.08
158 0.09
159 0.09
160 0.12
161 0.14
162 0.18
163 0.24
164 0.25
165 0.27
166 0.29
167 0.31
168 0.29
169 0.27
170 0.23
171 0.16
172 0.14
173 0.11
174 0.08
175 0.04
176 0.03
177 0.03
178 0.03
179 0.02
180 0.02
181 0.02
182 0.01
183 0.01
184 0.01
185 0.01
186 0.01
187 0.02
188 0.02
189 0.02
190 0.02
191 0.02
192 0.03
193 0.08
194 0.12
195 0.22
196 0.28
197 0.37
198 0.47
199 0.57
200 0.63
201 0.68
202 0.75
203 0.77
204 0.8
205 0.8
206 0.74
207 0.66
208 0.59
209 0.5
210 0.4
211 0.29
212 0.22
213 0.15
214 0.14
215 0.12
216 0.12
217 0.13
218 0.12
219 0.12
220 0.11
221 0.12
222 0.11
223 0.14
224 0.16
225 0.16
226 0.19
227 0.21
228 0.21
229 0.2
230 0.21
231 0.23
232 0.22
233 0.25
234 0.25
235 0.24
236 0.24
237 0.26
238 0.25
239 0.2
240 0.24
241 0.3
242 0.31
243 0.33
244 0.31
245 0.31
246 0.34
247 0.36
248 0.31
249 0.24
250 0.22
251 0.24
252 0.28
253 0.28
254 0.25
255 0.24
256 0.24
257 0.27
258 0.27
259 0.25
260 0.25
261 0.24
262 0.25