Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4W9D9

Protein Details
Accession Q4W9D9   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
102-121GPEKKRWRDEIRKNWKKVRWBasic
NLS Segment(s)
PositionSequence
105-118KKRWRDEIRKNWKK
Subcellular Location(s) nucl 10.5, cyto_nucl 9.333, cyto 7, cyto_mito 4.833, extr 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031352  SesA  
KEGG afm:AFUA_4G01170  -  
Pfam View protein in Pfam  
PF17107  SesA  
Amino Acid Sequences MAFQISIGDVLMLSKLAWDITQAFTSGRKSAPAEFQEVQNQLSSLTHALESLKSLSGESPGLDDGASASSITPILQNCRFTLEHLDALVKKYMIIENDGTGGPEKKRWRDEIRKNWKKVRWTREGGDLTRLQHNLGVHINSLNLTIAVLNSYSTGPIEAVQLVHYRNLTGDGAWVFNESADAILAARLDPIPIDSTEHEASEFTVTGELPQLHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.07
6 0.09
7 0.12
8 0.13
9 0.13
10 0.14
11 0.16
12 0.19
13 0.2
14 0.19
15 0.19
16 0.21
17 0.24
18 0.31
19 0.31
20 0.35
21 0.34
22 0.36
23 0.39
24 0.38
25 0.35
26 0.27
27 0.25
28 0.18
29 0.17
30 0.16
31 0.1
32 0.1
33 0.09
34 0.09
35 0.1
36 0.09
37 0.11
38 0.11
39 0.11
40 0.1
41 0.11
42 0.1
43 0.11
44 0.11
45 0.1
46 0.1
47 0.09
48 0.09
49 0.08
50 0.07
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.07
60 0.07
61 0.12
62 0.15
63 0.17
64 0.16
65 0.21
66 0.21
67 0.2
68 0.25
69 0.22
70 0.2
71 0.19
72 0.21
73 0.17
74 0.18
75 0.18
76 0.13
77 0.1
78 0.11
79 0.12
80 0.1
81 0.12
82 0.11
83 0.1
84 0.11
85 0.11
86 0.1
87 0.1
88 0.11
89 0.09
90 0.14
91 0.18
92 0.21
93 0.25
94 0.3
95 0.39
96 0.48
97 0.58
98 0.64
99 0.72
100 0.76
101 0.79
102 0.81
103 0.76
104 0.76
105 0.74
106 0.72
107 0.69
108 0.65
109 0.61
110 0.62
111 0.62
112 0.53
113 0.49
114 0.42
115 0.35
116 0.34
117 0.32
118 0.23
119 0.21
120 0.2
121 0.17
122 0.17
123 0.16
124 0.12
125 0.12
126 0.12
127 0.1
128 0.11
129 0.08
130 0.06
131 0.05
132 0.05
133 0.04
134 0.05
135 0.04
136 0.04
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.07
145 0.07
146 0.07
147 0.08
148 0.1
149 0.11
150 0.12
151 0.12
152 0.11
153 0.11
154 0.13
155 0.12
156 0.1
157 0.12
158 0.11
159 0.12
160 0.12
161 0.13
162 0.1
163 0.09
164 0.1
165 0.07
166 0.06
167 0.06
168 0.06
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.06
175 0.06
176 0.06
177 0.08
178 0.09
179 0.1
180 0.13
181 0.14
182 0.2
183 0.21
184 0.21
185 0.2
186 0.18
187 0.18
188 0.17
189 0.16
190 0.11
191 0.11
192 0.1
193 0.11
194 0.15