Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3HC14

Protein Details
Accession A0A0C3HC14    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-65LEEVNKRLSKRRRTKKTRLQKGGSLSHydrophilic
NLS Segment(s)
PositionSequence
45-59KRLSKRRRTKKTRLQ
Subcellular Location(s) cyto_nucl 12.833, nucl 11.5, mito_nucl 10.498, cyto 8, mito 7.5
Family & Domain DBs
Amino Acid Sequences ISQYQGSSPTPIIDAVNQFARGSVIIIYKVALLQSYITELEEVNKRLSKRRRTKKTRLQKGGSLSTKEADDLIAVIEVDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.18
5 0.17
6 0.16
7 0.16
8 0.13
9 0.12
10 0.1
11 0.09
12 0.08
13 0.09
14 0.09
15 0.08
16 0.08
17 0.07
18 0.06
19 0.05
20 0.05
21 0.05
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.08
28 0.11
29 0.12
30 0.13
31 0.16
32 0.16
33 0.25
34 0.34
35 0.42
36 0.51
37 0.6
38 0.7
39 0.77
40 0.87
41 0.9
42 0.92
43 0.93
44 0.92
45 0.86
46 0.81
47 0.78
48 0.77
49 0.72
50 0.64
51 0.54
52 0.46
53 0.41
54 0.35
55 0.28
56 0.18
57 0.13
58 0.09
59 0.08
60 0.07