Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CT31

Protein Details
Accession A0A0C3CT31   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
49-78SSCPFGAGNRPGRRRKRSKKEEAYDWGRDRBasic
NLS Segment(s)
PositionSequence
57-68NRPGRRRKRSKK
128-134DGRRRRR
Subcellular Location(s) mito 15.5, cyto_mito 11, cyto 5.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MRFHWRCLCLSAAPESDDPRNEDAKMVSGMHAPRPGTNREYDPRRIRHSSCPFGAGNRPGRRRKRSKKEEAYDWGRDRLETKGEEGEGGEMERAIELPRPEPFERKREIYATSQGRRPIPAVVHPWKDGRRRRRNLGPDVLRGWLECDVPYWQPMWAGSQRKGRHGRERAAREERTHACTVGTGDPRKGQSGTNDPMANVPAWVFPGAVINARHGWQVSGQYLLWKLSMGSERFTLSTLHPLPPTHALGPDVEVESGPFRHAAASSHGGPRAAGGCDGRPVERGLVDEGKAISETEREIHRVHSQSGDIQGRGNAAEKVQGFQRGVEQATRSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.33
4 0.33
5 0.35
6 0.33
7 0.34
8 0.3
9 0.3
10 0.27
11 0.26
12 0.26
13 0.23
14 0.19
15 0.22
16 0.24
17 0.26
18 0.29
19 0.27
20 0.29
21 0.32
22 0.36
23 0.34
24 0.37
25 0.4
26 0.45
27 0.51
28 0.56
29 0.61
30 0.63
31 0.68
32 0.7
33 0.67
34 0.69
35 0.72
36 0.7
37 0.62
38 0.6
39 0.53
40 0.49
41 0.52
42 0.49
43 0.5
44 0.51
45 0.58
46 0.63
47 0.72
48 0.79
49 0.83
50 0.86
51 0.88
52 0.9
53 0.92
54 0.94
55 0.92
56 0.9
57 0.89
58 0.85
59 0.83
60 0.75
61 0.68
62 0.57
63 0.49
64 0.41
65 0.35
66 0.32
67 0.24
68 0.23
69 0.21
70 0.21
71 0.2
72 0.19
73 0.17
74 0.12
75 0.12
76 0.09
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.08
83 0.09
84 0.11
85 0.13
86 0.19
87 0.21
88 0.29
89 0.33
90 0.37
91 0.41
92 0.43
93 0.44
94 0.4
95 0.42
96 0.38
97 0.43
98 0.44
99 0.43
100 0.43
101 0.44
102 0.42
103 0.4
104 0.37
105 0.31
106 0.24
107 0.25
108 0.3
109 0.33
110 0.34
111 0.35
112 0.39
113 0.41
114 0.49
115 0.53
116 0.56
117 0.6
118 0.65
119 0.71
120 0.76
121 0.78
122 0.77
123 0.79
124 0.72
125 0.65
126 0.59
127 0.52
128 0.43
129 0.34
130 0.27
131 0.18
132 0.14
133 0.1
134 0.09
135 0.1
136 0.1
137 0.11
138 0.1
139 0.09
140 0.09
141 0.09
142 0.11
143 0.15
144 0.19
145 0.23
146 0.3
147 0.32
148 0.4
149 0.48
150 0.49
151 0.53
152 0.56
153 0.58
154 0.59
155 0.63
156 0.63
157 0.62
158 0.59
159 0.51
160 0.51
161 0.47
162 0.44
163 0.39
164 0.32
165 0.24
166 0.23
167 0.23
168 0.21
169 0.23
170 0.19
171 0.19
172 0.22
173 0.23
174 0.24
175 0.22
176 0.18
177 0.18
178 0.24
179 0.26
180 0.27
181 0.27
182 0.25
183 0.25
184 0.25
185 0.2
186 0.13
187 0.11
188 0.07
189 0.07
190 0.07
191 0.06
192 0.05
193 0.07
194 0.07
195 0.1
196 0.1
197 0.11
198 0.12
199 0.13
200 0.14
201 0.12
202 0.12
203 0.1
204 0.13
205 0.12
206 0.12
207 0.12
208 0.13
209 0.14
210 0.14
211 0.13
212 0.1
213 0.09
214 0.11
215 0.16
216 0.15
217 0.16
218 0.16
219 0.17
220 0.18
221 0.18
222 0.17
223 0.12
224 0.2
225 0.21
226 0.22
227 0.23
228 0.23
229 0.25
230 0.27
231 0.29
232 0.22
233 0.21
234 0.19
235 0.18
236 0.19
237 0.18
238 0.15
239 0.12
240 0.1
241 0.1
242 0.11
243 0.11
244 0.1
245 0.08
246 0.08
247 0.09
248 0.09
249 0.1
250 0.14
251 0.19
252 0.21
253 0.24
254 0.25
255 0.25
256 0.24
257 0.24
258 0.21
259 0.17
260 0.16
261 0.14
262 0.14
263 0.18
264 0.19
265 0.19
266 0.18
267 0.18
268 0.18
269 0.17
270 0.18
271 0.19
272 0.21
273 0.2
274 0.21
275 0.2
276 0.19
277 0.18
278 0.17
279 0.13
280 0.11
281 0.12
282 0.13
283 0.15
284 0.18
285 0.18
286 0.22
287 0.29
288 0.31
289 0.32
290 0.32
291 0.31
292 0.32
293 0.39
294 0.4
295 0.32
296 0.3
297 0.29
298 0.27
299 0.26
300 0.25
301 0.18
302 0.14
303 0.19
304 0.18
305 0.19
306 0.22
307 0.27
308 0.25
309 0.25
310 0.3
311 0.28
312 0.3
313 0.32