Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3GY13

Protein Details
Accession A0A0C3GY13    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MDAPVLKNKRRKKSRSRTQVSDSEPHydrophilic
NLS Segment(s)
PositionSequence
7-16KNKRRKKSRS
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MDAPVLKNKRRKKSRSRTQVSDSEPETSSPAVPSSPKKPQQAQDSSIDSMTEAEVTAAFTQFYARQTTQEFAEDLDRVRRAEDFREVEGVEMLITALRQGASLFSIDEMRRVVRAEREKERARAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.92
4 0.89
5 0.86
6 0.84
7 0.78
8 0.73
9 0.63
10 0.56
11 0.47
12 0.39
13 0.34
14 0.26
15 0.21
16 0.15
17 0.14
18 0.12
19 0.14
20 0.18
21 0.23
22 0.32
23 0.38
24 0.44
25 0.49
26 0.55
27 0.61
28 0.63
29 0.6
30 0.56
31 0.52
32 0.47
33 0.41
34 0.34
35 0.24
36 0.18
37 0.14
38 0.09
39 0.05
40 0.04
41 0.04
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.05
48 0.06
49 0.08
50 0.11
51 0.11
52 0.12
53 0.14
54 0.15
55 0.15
56 0.15
57 0.13
58 0.11
59 0.12
60 0.11
61 0.11
62 0.13
63 0.13
64 0.12
65 0.13
66 0.14
67 0.14
68 0.17
69 0.23
70 0.23
71 0.23
72 0.25
73 0.24
74 0.22
75 0.21
76 0.18
77 0.1
78 0.07
79 0.06
80 0.04
81 0.04
82 0.03
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.06
89 0.06
90 0.07
91 0.07
92 0.12
93 0.12
94 0.13
95 0.14
96 0.15
97 0.16
98 0.17
99 0.2
100 0.25
101 0.34
102 0.4
103 0.47
104 0.56
105 0.61
106 0.64